DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and shu

DIOPT Version :9

Sequence 1:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster


Alignment Length:439 Identity:87/439 - (19%)
Similarity:150/439 - (34%) Gaps:137/439 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DGGVLKEILKEG-TGTETPHSGCTVSLHYTGRLVDGT-EFDSSLSRNEPFEFSLGKGNVIKAFDM 74
            |..:.|.|.:.| ...|...:...||:.|:|.....| .|||||.|...|.|..|:|.|::..::
  Fly    82 DENIYKRITRTGHVDREAVPNKARVSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEV 146

  Fly    75 GVATMKLGERCFLTCAPNYAYGAAGSPPAIPPDATLIFELEMLGW------KGEDLSPNQDGSID 133
            .|.:|:..|:.....:....:|..|.||.|.|.|..:|::|::.:      ||.|..|.      
  Fly   147 AVRSMRPYEQAEFIISYKLLFGELGCPPRIKPKADALFKVEVIDYSLIGDAKGIDAIPQ------ 205

  Fly   134 RTILEASDKKRTPSDGAFVKAHISGSFEGRVFEDRDVEFDYGEGKAIGIIDGVEIALEKMNVGET 198
                                            ||||                             
  Fly   206 --------------------------------EDRD----------------------------- 209

  Fly   199 SRIKIQAKYAFGAKGNEEFKIPPNATVEYTVKLVDCG-KGLEEWKLSDEERLAEAKVYKEKGTNY 262
                   |:.                |.|. |.||.. .|.:..||...:..|.|........||
  Fly   210 -------KFC----------------VVYP-KAVDLHLHGKDSVKLGRYQSAATAFERAVSSLNY 250

  Fly   263 FKKENWALAIKMYTKCKNILPTTVHTNEEVKKIKVAT--HSNIALCHQKSNDHFEAKQECNEV-- 323
            .:..|                    ..||.|:.::.|  :.|:.:.:.|.|   :.|:.|..:  
  Fly   251 CRMAN--------------------DEEERKQTELLTTLNQNLMIVYNKMN---KPKRACIMMKA 292

  Fly   324 ---LALDKNNVKALYRRGQCNLTINELEDALEDFQKVIQLEPGNKAAANQVIICKQKLKESKNKE 385
               |.:...:.|||::.|:....:.|...|...:.:....:|.||..::::|...:::.:.:...
  Fly   293 LRHLTMGNPSCKALFQEGRALAALGEYNLARNAYLQAQAKQPANKEISDEIISMNKRISKYEEAS 357

  Fly   386 KKLYANMFT-KLAANDKETEPPRETDVLSKCGEWSEEDAKREAELTLER 433
            :.::|..|: |.:.:|....|.:    |.|  |..|:|...:.|..:.|
  Fly   358 RDIWARAFSLKNSKSDVRKTPAQ----LEK--EAKEQDFNDKMEDLIRR 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674 29/92 (32%)
ppisom_GldI <124..233 CDD:132555 9/108 (8%)
BamD 252..>390 CDD:276939 24/144 (17%)
TPR_12 252..329 CDD:290160 14/83 (17%)
TPR repeat 252..280 CDD:276939 4/27 (15%)
TPR repeat 252..280 CDD:276809 4/27 (15%)
TPR repeat 287..326 CDD:276939 10/45 (22%)
TPR repeat 296..326 CDD:276809 7/36 (19%)
TPR_11 299..362 CDD:290150 13/69 (19%)
TPR repeat 329..361 CDD:276939 6/31 (19%)
TPR_1 331..364 CDD:278916 7/32 (22%)
TPR repeat 331..359 CDD:276809 6/27 (22%)
shuNP_611837.1 FKBP_C 96..189 CDD:278674 29/92 (32%)
TPR repeat 218..257 CDD:276809 10/58 (17%)
TPR repeat 262..295 CDD:276809 6/35 (17%)
TPR repeat 304..329 CDD:276809 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452526
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.