DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and stimate

DIOPT Version :9

Sequence 1:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001005033.2 Gene:stimate / 448551 XenbaseID:XB-GENE-5830208 Length:293 Species:Xenopus tropicalis


Alignment Length:174 Identity:36/174 - (20%)
Similarity:64/174 - (36%) Gaps:47/174 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 VKLVDCGKGLEEWKLSDEERLAEAKVYKEKGTNYFKKENWA------LAIKMYTKCKNILPTTVH 287
            |::|.|   :.||:..:..|..|   |.|.    .:.:.|.      :.|.|:.|...||...:.
 Frog   121 VRVVSC---IVEWRQWESLRFGE---YGEP----MQCKAWVGQCALYIVIMMFEKAAIILVLLIP 175

  Fly   288 TNEEVKKIKVATHSNIALCHQK-------------SNDHF-------EAKQECNEVLALDKNNVK 332
            ..:||.|:|...:..:.|....             ..|:|       :||.|..|.....:|...
 Frog   176 HLKEVAKVKPIKNPQLELATVMLIVPFFVNALMFWVVDNFLMKKGKTKAKTEEREGSPDSRNGTT 240

  Fly   333 ALYRR------GQCNLTI---NELEDA--LEDFQKVIQLEPGNK 365
            ..|||      .:..:.|   :|:|::  .:|.:::...:|..|
 Frog   241 VRYRRTASYDESESEILISADDEMEESEGEDDLRRLTNSKPVKK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674
ppisom_GldI <124..233 CDD:132555 1/3 (33%)
BamD 252..>390 CDD:276939 29/151 (19%)
TPR_12 252..329 CDD:290160 19/102 (19%)
TPR repeat 252..280 CDD:276939 6/33 (18%)
TPR repeat 252..280 CDD:276809 6/33 (18%)
TPR repeat 287..326 CDD:276939 11/58 (19%)
TPR repeat 296..326 CDD:276809 8/49 (16%)
TPR_11 299..362 CDD:290150 15/93 (16%)
TPR repeat 329..361 CDD:276939 8/42 (19%)
TPR_1 331..364 CDD:278916 8/43 (19%)
TPR repeat 331..359 CDD:276809 7/38 (18%)
stimateNP_001005033.2 STIMATE 99..218 CDD:372090 22/106 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.