DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Fkbp59 and fkbp2

DIOPT Version :9

Sequence 1:	NP_001285784.1	Gene:	Fkbp59 / 47762	FlyBaseID:	FBgn0029174	Length:	439	Species:	Drosophila melanogaster
Sequence 2:	NP_001004677.2	Gene:	fkbp2 / 447939	ZFINID:	ZDB-GENE-040912-126	Length:	138	Species:	Danio rerio

Alignment Length:	86	Identity:	46/86 - (53%)
Similarity:	59/86 - (68%)	Gaps:	0/86 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    32 GCTVSLHYTGRLVDGTEFDSSLSRNEPFEFSLGKGNVIKAFDMGVATMKLGERCFLTCAPNYAYG 96
            |..:::||||:|.||||||||:.||:||.|:||.|.|||.:|.|:..|..||:..|.......||
Zfish    45 GDVLNMHYTGKLEDGTEFDSSIPRNQPFTFTLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYG 109

  Fly    97 AAGSPPAIPPDATLIFELEML 117
            ..|:||.||..||||||:|:|
Zfish   110 DRGAPPKIPGGATLIFEVELL 130

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Fkbp59	NP_001285784.1	FKBP_C	25..117	CDD:278674	45/84 (54%)
		ppisom_GldI	<124..233	CDD:132555
		BamD	252..>390	CDD:276939
		TPR_12	252..329	CDD:290160
		TPR repeat	252..280	CDD:276939
		TPR repeat	252..280	CDD:276809
		TPR repeat	287..326	CDD:276939
		TPR repeat	296..326	CDD:276809
		TPR_11	299..362	CDD:290150
		TPR repeat	329..361	CDD:276939
		TPR_1	331..364	CDD:278916
		TPR repeat	331..359	CDD:276809
fkbp2	NP_001004677.2	FKBP_C	38..130	CDD:278674	45/84 (54%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0545
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.810