DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and fkbp9

DIOPT Version :9

Sequence 1:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001003520.1 Gene:fkbp9 / 445126 ZFINID:ZDB-GENE-040801-23 Length:564 Species:Danio rerio


Alignment Length:248 Identity:69/248 - (27%)
Similarity:123/248 - (49%) Gaps:30/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 HYTGRLVDGTEFDSSLSRNEPFEFSLGKGNVIKAFDMGVATMKLGERCFLTCAPNYAYGAAGSPP 102
            ||.|.|:|||.||||.|||..::..:|||.||...|.|:..:.:|||..:|..|:.|||..|:..
Zfish   277 HYNGSLLDGTFFDSSYSRNHTYDTYIGKGYVIAGMDQGLLGVCVGERRRITIPPHLAYGEEGTGT 341

  Fly   103 AIPPDATLIFELEMLGWKGEDLSPNQDGSIDRTILEASDKKRTPSDGAFVKAHISGSFEGRVFED 167
            .||..|.|:|::.::.:.      |...:::.|.::..:.......|.|||.|    :...:.:.
Zfish   342 KIPGSAVLVFDVHII
DFH------NPSDTVEITSVKLENCTYNAKRGDFVKYH----YNATLMDG 396

  Fly   168 RDVEFDYGEGKAIG-------IIDGVEIALEKMNVGETSRIKIQAKYAFGAKGNEEFKIPPNATV 225
            .|:...:..||...       ::.|:|..|..|.:||..::.|....|:|.:| .:.::|.:|.:
Zfish   397 TDIGSTHMYGKTYNVVLGSGQVVIGMEQGLTGMCIGEKRKLVIPPHLAYGERG-VDGEVPGSAVL 460

  Fly   226 EYTVKLVDCGKGLEE-----WK-------LSDEERLAEAKVYKEKGTNYFKKE 266
            .:.|::||..:||.|     |.       .|:.::..:|:|.|.:.::|..::
Zfish   461 VFEVEMV
DVEEGLPEGYMFVWNNNVTPDLFSEMDKNKDAQVDKTEFSDYILQQ 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674 35/78 (45%)
ppisom_GldI <124..233 CDD:132555 23/115 (20%)
BamD 252..>390 CDD:276939 4/15 (27%)
TPR_12 252..329 CDD:290160 4/15 (27%)
TPR repeat 252..280 CDD:276939 4/15 (27%)
TPR repeat 252..280 CDD:276809 4/15 (27%)
TPR repeat 287..326 CDD:276939
TPR repeat 296..326 CDD:276809
TPR_11 299..362 CDD:290150
TPR repeat 329..361 CDD:276939
TPR_1 331..364 CDD:278916
TPR repeat 331..359 CDD:276809
fkbp9NP_001003520.1 FKBP_C 40..132 CDD:278674
FKBP_C 152..244 CDD:278674
FKBP_C 264..356 CDD:278674 35/78 (45%)
FKBP_C 375..467 CDD:278674 21/96 (22%)
EF-hand_7 488..552 CDD:290234 5/26 (19%)
EFh 490..551 CDD:298682 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.