DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and Fkbp39

DIOPT Version :9

Sequence 1:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster


Alignment Length:108 Identity:45/108 - (41%)
Similarity:72/108 - (66%) Gaps:3/108 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSGDGGVLKEILKEGTGTETPHSGCTVSLHYTGRLVDGTEFDSSLSRNEPFEFSLGKGNVIKAFD 73
            ::|...::.:::.:|   |....|..||::|.|||....:...||.:.:||:|:||.|.|||.:|
  Fly   249 ITGGVKIVDQVVGKG---EEAKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWD 310

  Fly    74 MGVATMKLGERCFLTCAPNYAYGAAGSPPAIPPDATLIFELEM 116
            :|||.||:|.:..:||.|:.||||.|:||.|.|::||:||:|:
  Fly   311 VGVAGMKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFEVEL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674 43/92 (47%)
ppisom_GldI <124..233 CDD:132555
BamD 252..>390 CDD:276939
TPR_12 252..329 CDD:290160
TPR repeat 252..280 CDD:276939
TPR repeat 252..280 CDD:276809
TPR repeat 287..326 CDD:276939
TPR repeat 296..326 CDD:276809
TPR_11 299..362 CDD:290150
TPR repeat 329..361 CDD:276939
TPR_1 331..364 CDD:278916
TPR repeat 331..359 CDD:276809
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 44/95 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452517
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D96564at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.