DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and stimate

DIOPT Version :9

Sequence 1:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_956761.1 Gene:stimate / 393439 ZFINID:ZDB-GENE-040426-1198 Length:298 Species:Danio rerio


Alignment Length:72 Identity:18/72 - (25%)
Similarity:31/72 - (43%) Gaps:18/72 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 DHF-----EAKQECNEVLALD--KNNVKALYRRGQCN---------LTINELEDAL--EDFQKVI 358
            |:|     ..|.:..|.:|.|  :.|.|..|||...:         ...:|:||:.  :|.:::.
Zfish   218 DNFLMKKGRTKAKLEERVAEDDPRGNSKVRYRRALSHDDSESEILFSADDEMEDSEGDDDVRRIT 282

  Fly   359 QLEPGNK 365
            .|:|..|
Zfish   283 GLKPVKK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674
ppisom_GldI <124..233 CDD:132555
BamD 252..>390 CDD:276939 18/72 (25%)
TPR_12 252..329 CDD:290160 6/23 (26%)
TPR repeat 252..280 CDD:276939
TPR repeat 252..280 CDD:276809
TPR repeat 287..326 CDD:276939 4/18 (22%)
TPR repeat 296..326 CDD:276809 4/18 (22%)
TPR_11 299..362 CDD:290150 16/67 (24%)
TPR repeat 329..361 CDD:276939 9/42 (21%)
TPR_1 331..364 CDD:278916 10/43 (23%)
TPR repeat 331..359 CDD:276809 8/38 (21%)
stimateNP_956761.1 DUF3661 104..223 CDD:289186 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.