powered by:
Protein Alignment Fkbp59 and stimate
DIOPT Version :9
Sequence 1: | NP_001285784.1 |
Gene: | Fkbp59 / 47762 |
FlyBaseID: | FBgn0029174 |
Length: | 439 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_956761.1 |
Gene: | stimate / 393439 |
ZFINID: | ZDB-GENE-040426-1198 |
Length: | 298 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 18/72 - (25%) |
Similarity: | 31/72 - (43%) |
Gaps: | 18/72 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 312 DHF-----EAKQECNEVLALD--KNNVKALYRRGQCN---------LTINELEDAL--EDFQKVI 358
|:| ..|.:..|.:|.| :.|.|..|||...: ...:|:||:. :|.:::.
Zfish 218 DNFLMKKGRTKAKLEERVAEDDPRGNSKVRYRRALSHDDSESEILFSADDEMEDSEGDDDVRRIT 282
Fly 359 QLEPGNK 365
.|:|..|
Zfish 283 GLKPVKK 289
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D897391at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.