DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and Fkbp9

DIOPT Version :9

Sequence 1:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_036186.2 Gene:Fkbp9 / 27055 MGIID:1350921 Length:570 Species:Mus musculus


Alignment Length:216 Identity:75/216 - (34%)
Similarity:111/216 - (51%) Gaps:23/216 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TPHSGCTVSLHYTGRLVDGTEFDSSLSRNEPFEFSLGKGNVIKAFDMGVATMKLGERCFLTCAPN 92
            |.|||..|..||.|..:||.:||||..|:..|...:|||.:|...|..:..|.:.||..:|..||
Mouse    50 TVHSGDFVRYHYVGTFLDGQKFDSSYDRDSTFNVFVGKGQLIAGMDQALVGMCVNERRLVTIPPN 114

  Fly    93 YAYGAAGSPPAIPPDATLIFELEMLG-WKGEDLSPNQ----DGSIDRTILEASDKKRTPSDGAFV 152
            .|||:.|....|||::.|.|::.::. |..||....|    ..|..||| :.||         ||
Mouse   115 LAYGSEGVSGVIPPNSVLHFDVLLV
DIWNSEDQVHIQTYFKPPSCPRTI-QVSD---------FV 169

  Fly   153 KAHISGSF-EGRVFE---DRDVEFDYGEGKAIG-IIDGVEIALEKMNVGETSRIKIQAKYAFGAK 212
            :.|.:|:| :|.:|:   :|...:|...|  || :|.|::..|..|.|||...|.:....|:|.:
Mouse   170 RYHYNGTFLDGTLFDSSHNRMKTYDTYVG--IGWLIPGMDKGLLGMCVGEKRIITVPPFLAYGEE 232

  Fly   213 GNEEFKIPPNATVEYTVKLVD 233
            |:.: .||..|::.:.|.|:|
Mouse   233 GDGK-DIPGQASLVFDVALLD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674 36/88 (41%)
ppisom_GldI <124..233 CDD:132555 35/117 (30%)
BamD 252..>390 CDD:276939
TPR_12 252..329 CDD:290160
TPR repeat 252..280 CDD:276939
TPR repeat 252..280 CDD:276809
TPR repeat 287..326 CDD:276939
TPR repeat 296..326 CDD:276809
TPR_11 299..362 CDD:290150
TPR repeat 329..361 CDD:276939
TPR_1 331..364 CDD:278916
TPR repeat 331..359 CDD:276809
Fkbp9NP_036186.2 FKBP_C 47..139 CDD:278674 36/88 (41%)
FKBP_C 159..251 CDD:278674 32/104 (31%)
FKBP_C 271..362 CDD:278674
FKBP_C 382..474 CDD:278674
EF-hand_7 495..559 CDD:290234
EFh 497..558 CDD:238008
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 567..570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.