DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and CG30075

DIOPT Version :9

Sequence 1:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster


Alignment Length:116 Identity:25/116 - (21%)
Similarity:46/116 - (39%) Gaps:13/116 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 ILPTTVHTNEEVKKIKVATHSNIALCHQKSNDHFEAKQECNEVLALDKNNVKALYRRGQCNLTIN 345
            :||......:..|..|.:||   ||.::..||...:..|.:::..|.......|::.|:..:...
  Fly     1 MLPNDKKGFKAAKNDKFSTH---ALLNENDNDQSLSSDEQDDIFFLIYRKAHTLFQAGKLWMRRM 62

  Fly   346 ELEDALEDFQKVIQLEPGNKAAANQVIICKQKLKESKNKEKKLYANMFTKL 396
            ...||...|:|.|          .::..||....|.:.::|.:...:|..|
  Fly    63 RYHDAQRAFEKAI----------TRLKTCKTSSFEQQCRKKDMLIALFESL 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674
ppisom_GldI <124..233 CDD:132555
BamD 252..>390 CDD:276939 23/108 (21%)
TPR_12 252..329 CDD:290160 12/47 (26%)
TPR repeat 252..280 CDD:276939
TPR repeat 252..280 CDD:276809
TPR repeat 287..326 CDD:276939 9/38 (24%)
TPR repeat 296..326 CDD:276809 8/29 (28%)
TPR_11 299..362 CDD:290150 15/62 (24%)
TPR repeat 329..361 CDD:276939 7/31 (23%)
TPR_1 331..364 CDD:278916 7/32 (22%)
TPR repeat 331..359 CDD:276809 6/27 (22%)
CG30075NP_725390.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.