DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and FKBP8

DIOPT Version :9

Sequence 1:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_036313.3 Gene:FKBP8 / 23770 HGNCID:3724 Length:413 Species:Homo sapiens


Alignment Length:398 Identity:103/398 - (25%)
Similarity:169/398 - (42%) Gaps:81/398 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EFDSSLSRNEPFEFSLGKGNVIKAFDMGVATMKLGE------RCFLTCAPNYAYGAAGSP---PA 103
            |.:..||...|.|            |||....:..|      |.||         ||..|   ||
Human    44 EEEDDLSELPPLE------------DMGQPPAEEAEQPGALAREFL---------AAMEPEPAPA 87

  Fly   104 IPPDATLIFELEMLG---WKGEDLSPNQDGSIDRTILEASDKKRTPSDGAFVKAHISGSFEG--R 163
            ..|:..    |::||   .:.:.|.|...||            ..|..|..|..|:..|.|.  |
Human    88 PAPEEW----LDILGNGLLRKKTLVPGPPGS------------SRPVKGQVVTVHLQTSLENGTR 136

  Fly   164 VFEDRDVEFDYGEGKAIGIIDGVEIALEKMNVGETSRIKIQAKYAFGAKGNEEFKIPPNAT--VE 226
            |.|:.::.|..|:   ..:|..:::::..|:||||:.:...:||.:|.:|:....|||:|.  :|
Human   137 VQEEPELVFTLGD---CDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLE 198

  Fly   227 YTVKLVDCGKGLEEWKLSDEERLAEAKVYKEKGTNYFKK-------ENWALAIKMYTKCKNILPT 284
            .|:|....|..||  .|:.:||:|.|...:|.|..::::       .::.||||..|....: ..
Human   199 VTLKTAVDGPDLE--MLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKV-DM 260

  Fly   285 TVHTNEEVKKIKVATHSNIALCHQKSNDHFEAKQECNEVLALDKNNVKALYRRGQCNLTINELED 349
            |.....::.::||...:|:|....|.:.:..|.:.|:.||....:|:|||:|:|:......|..:
Human   261 TFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSE 325

  Fly   350 ALEDFQKVIQLEPGNKAAANQVIICKQKLKESKNKEKKLYANMFTKLAANDKETEPPRETDVLSK 414
            |:...:..::|||.||....::....:|....::.|..||..|.         ..|.|   :.:|
Human   326 AIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKML---------GNPSR---LPAK 378

  Fly   415 C---GEWS 419
            |   |.||
Human   379 CPGKGAWS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674 19/77 (25%)
ppisom_GldI <124..233 CDD:132555 32/112 (29%)
BamD 252..>390 CDD:276939 34/144 (24%)
TPR_12 252..329 CDD:290160 18/83 (22%)
TPR repeat 252..280 CDD:276939 8/34 (24%)
TPR repeat 252..280 CDD:276809 8/34 (24%)
TPR repeat 287..326 CDD:276939 9/38 (24%)
TPR repeat 296..326 CDD:276809 9/29 (31%)
TPR_11 299..362 CDD:290150 16/62 (26%)
TPR repeat 329..361 CDD:276939 8/31 (26%)
TPR_1 331..364 CDD:278916 10/32 (31%)
TPR repeat 331..359 CDD:276809 7/27 (26%)
FKBP8NP_036313.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..68 8/35 (23%)
FKBP_C 113..202 CDD:278674 29/103 (28%)
TPR_11 222..304 CDD:290150 18/82 (22%)
TPR 1 222..255 8/32 (25%)
TPR repeat 231..267 CDD:276809 6/36 (17%)
TPR repeat 272..302 CDD:276809 9/29 (31%)
TPR 2 273..306 8/32 (25%)
TPR_11 274..338 CDD:290150 16/63 (25%)
TPR 3 307..340 10/32 (31%)
TPR 307..340 CDD:197478 10/32 (31%)
TPR repeat 307..335 CDD:276809 7/27 (26%)
TPR repeat 341..369 CDD:276809 5/27 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.