DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and FKBP4

DIOPT Version :9

Sequence 1:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_002005.1 Gene:FKBP4 / 2288 HGNCID:3720 Length:459 Species:Homo sapiens


Alignment Length:420 Identity:186/420 - (44%)
Similarity:276/420 - (65%) Gaps:11/420 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EGNKIDLSGDGGVLKEILKEGTGTETPHSGCTVSLHYTGRLVDGTEFDSSLSRNEPFEFSLGKGN 67
            ||..|....|.||||.|.:||||||.|..|..|.:||||.|:|||:|||||.|.:.|.|.||||.
Human    21 EGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGE 85

  Fly    68 VIKAFDMGVATMKLGERCFLTCAPNYAYGAAGSPPAIPPDATLIFELEMLGWKGEDLSPNQDGSI 132
            ||||:|:.:||||:||.|.:||.|.||||:|||||.|||:|||:||:|:..:|||||:..:||.|
Human    86 VIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGI 150

  Fly   133 DRTILEASDKKRTPSDGAFVKAHISGSFEGRVFEDRDVEFDYGEGKAIGIIDGVEIALEKMNVGE 197
            .|.|....:....|::||.|:..:.|.::.::|:.|::.|:.|||:.:.:..|:|.|:::|..||
Human   151 IRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGE 215

  Fly   198 TSRIKIQAKYAFGAKGNEEFKIPPNATVEYTVKLVDCGKGLEEWKLSDEERLAEAKVYKEKGTNY 262
            .|.:.::..||||:.|.|:|:|||||.::|.:.|....|..|.|:::.||:|.::.:.||:||.|
Human   216 HSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVY 280

  Fly   263 FKKENWALAIKMYTKCKNILP-TTVHTNEEVKK---IKVATHSNIALCHQKSNDHFEAKQECNEV 323
            ||:..:..|:..|.|..:.|. .:..:|||.:|   :::|:|.|:|:||.|......|.:.||:.
Human   281 FKEGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKA 345

  Fly   324 LALDKNNVKALYRRGQCNLTINELEDALEDFQKVIQLEPGNKAAANQVIICKQKLKESKNKEKKL 388
            |.||.||.|.|:|||:.:|.:|:.|.|..|||||:||.|.||||..|:.:|:|:::....:||||
Human   346 LELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKL 410

  Fly   389 YANMFTKLAANDKET-------EPPRETDV 411
            |||||.:||..:.:.       :.|.:|::
Human   411 YANMFERLAEEENKAKAEASSGDHPTDTEM 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674 59/91 (65%)
ppisom_GldI <124..233 CDD:132555 38/108 (35%)
BamD 252..>390 CDD:276939 58/141 (41%)
TPR_12 252..329 CDD:290160 28/80 (35%)
TPR repeat 252..280 CDD:276939 10/27 (37%)
TPR repeat 252..280 CDD:276809 10/27 (37%)
TPR repeat 287..326 CDD:276939 15/41 (37%)
TPR repeat 296..326 CDD:276809 11/29 (38%)
TPR_11 299..362 CDD:290150 30/62 (48%)
TPR repeat 329..361 CDD:276939 17/31 (55%)
TPR_1 331..364 CDD:278916 17/32 (53%)
TPR repeat 331..359 CDD:276809 14/27 (52%)
FKBP4NP_002005.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 2/2 (100%)
FKBP_C 43..134 CDD:306713 58/90 (64%)
FKBP_N <155..254 CDD:332399 32/98 (33%)
TPR_11 <250..>395 CDD:330823 58/144 (40%)
Interaction with tubulin. /evidence=ECO:0000250 267..400 55/132 (42%)
TPR repeat 274..301 CDD:276809 10/26 (38%)
TPR repeat 306..348 CDD:276809 15/41 (37%)
TPR repeat 353..381 CDD:276809 14/27 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 421..459 2/20 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5369
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H36085
Inparanoid 1 1.050 372 1.000 Inparanoid score I2122
Isobase 1 0.950 - 0 Normalized mean entropy S1457
OMA 1 1.010 - - QHG54040
OrthoDB 1 1.010 - - D531594at33208
OrthoFinder 1 1.000 - - FOG0002252
OrthoInspector 1 1.000 - - otm42094
orthoMCL 1 0.900 - - OOG6_100299
Panther 1 1.100 - - LDO PTHR10516
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1919
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.