DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and fkb-1

DIOPT Version :10

Sequence 1:NP_524895.2 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001255531.1 Gene:fkb-1 / 191634 WormBaseID:WBGene00001426 Length:139 Species:Caenorhabditis elegans


Alignment Length:95 Identity:48/95 - (50%)
Similarity:66/95 - (69%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GCTVSLHYTGRLVDGTEFDSSLSRNEPFEFSLGKGNVIKAFDMGVATMKLGERCFLTCAPNYAYG 96
            |..:.:||||.|:||||||||.:|||.|.|:||:|||||.:|.|:..|.:|||..||..|:..||
 Worm    45 GDQLHMHYTGTLLDGTEFDSSRTRNEEFTFTLGQGNVIKGWDQGLLNMCVGERRILTIPPHLGYG 109

  Fly    97 AAGSPPAIPPDATLIFELEM--LGWKGEDL 124
            ..|:||.||.::.|.|::|:  :...||:|
 Worm   110 ERGAPPKIPGNSVLKFDVELMKIDRDGEEL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_524895.2 FKBP_C 25..117 CDD:459735 45/86 (52%)
SlpA 147..>210 CDD:440668
NlpI <245..402 CDD:443815
TPR repeat 252..280 CDD:276809
TPR repeat 296..326 CDD:276809
TPR repeat 331..359 CDD:276809
fkb-1NP_001255531.1 FKBP_C 38..129 CDD:459735 44/83 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.