DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and Fkbp39

DIOPT Version :10

Sequence 1:NP_524895.2 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_308400.5 Gene:Fkbp39 / 1269751 VectorBaseID:AGAMI1_006772 Length:370 Species:Anopheles gambiae


Alignment Length:103 Identity:42/103 - (40%)
Similarity:63/103 - (61%) Gaps:1/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GVLKEILKEGTGTETPHSGCTVSLHYTGRLVDGTEFDSSLSRNEPFEFSLGKGNVIKAFDMGVAT 78
            |::.|.||.|.|.|. ..|..::::|.|||....:...|.::....:|:||:|.|:|.:|:|||.
Mosquito   265 GLMVEDLKVGNGPEA-KPGKKIAVYYEGRLKSNNKVFDSTNKGPGLKFTLGRGEVVKGWDLGVAG 328

  Fly    79 MKLGERCFLTCAPNYAYGAAGSPPAIPPDATLIFELEM 116
            ||:|.:..|......|||..||||.|||.:||:||:|:
Mosquito   329 MKVGGKRRLVIPHKLAYGTKGSPPVIPPCSTLVFEVEL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_524895.2 FKBP_C 25..117 CDD:459735 37/92 (40%)
SlpA 147..>210 CDD:440668
NlpI <245..402 CDD:443815
TPR repeat 252..280 CDD:276809
TPR repeat 296..326 CDD:276809
TPR repeat 331..359 CDD:276809
Fkbp39XP_308400.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.