DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and STIMATE-MUSTN1

DIOPT Version :9

Sequence 1:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001185903.2 Gene:STIMATE-MUSTN1 / 100526772 HGNCID:38834 Length:372 Species:Homo sapiens


Alignment Length:87 Identity:23/87 - (26%)
Similarity:37/87 - (42%) Gaps:20/87 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 KNNVKALYRR------GQCNLTI---NELE--DALEDFQKVIQLEP--------GNKAAANQVII 373
            :|..|..|||      .:..:.|   :|:|  |..||.:::..|:|        |..|.|.:..|
Human   237 RNGSKVRYRRAASHEESESEILISADDEMEESDVEEDLRRLTPLKPVKKKKHRFGLPAGAQEAPI 301

  Fly   374 CKQKLKESKNKEKKLYANMFTK 395
             |:|....|:::.|......||
Human   302 -KKKRPPVKDEDLKGARGNLTK 322

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674
ppisom_GldI <124..233 CDD:132555
BamD 252..>390 CDD:276939 21/80 (26%)