DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaggt-II and CG17565

DIOPT Version :9

Sequence 1:NP_524894.1 Gene:betaggt-II / 47757 FlyBaseID:FBgn0028970 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_650540.1 Gene:CG17565 / 41989 FlyBaseID:FBgn0038424 Length:419 Species:Drosophila melanogaster


Alignment Length:301 Identity:92/301 - (30%)
Similarity:143/301 - (47%) Gaps:26/301 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IYWGTTALDIMG-QLERLERKSIIEFVKRCQCPNTGGFAPCEGHDPHLLYTLSAIQILC---TYD 121
            :||...|..::. ..:......:::|:..|:.| ||||....|...||..|.:|:..||   :..
  Fly    91 VYWILQAAQLLSFNFDDQTLNHVVQFLSNCRSP-TGGFGGGPGQYAHLAPTYAAVNSLCIIGSEQ 154

  Fly   122 ALEEIDREAVVRFVVGLQQPDGSFFGDKWGEVDTRFSFCAVASLTLLGRMEQTI-DVEKAVKFVL 185
            |...|||..:|:|:..::..||||.....||.|.|.::||::...||...|..| ::.......:
  Fly   155 AYRAIDRPTLVQFLFSVRDSDGSFRLHVDGETDVRGAYCAISCAKLLNLPEPVIKELFAGTGDWI 219

  Fly   186 SCCNQTDGGFGSKPGAESHAGLIYCCVGFFSLTHRLHLLDVDKLGWWLCERQLP-SGGLNGRPEK 249
            :.|...:||||..||.|:|.|..:|.:...:|.:.....|...|..|...||:. .||..||..|
  Fly   220 AQCQTYEGGFGGAPGLEAHGGYTFCGIAGLALLNEADKCDRQALLKWTLRRQMTYEGGFQGRTNK 284

  Fly   250 LPDVCYSWWVLASLTI-MGRLHWISS---------EKLQQFILSCQDTETGGFSDRTGNMPDIFH 304
            |.|.|||:||.|::.| ...|..:..         |.||::||.|...::||..|:.|...|::|
  Fly   285 LVDGCYSFWVGATIPITQATLSGVDKQMEHTLFDVEALQEYILLCCQKQSGGLIDKPGKPQDLYH 349

  Fly   305 TLFGIGGLSLLGHSGLKAINPTLCMPQYIIDRLGIKPQLLP 345
            |.:.:.|:|:..||...:      .||.:.|.:.   :|||
  Fly   350 TCYTLSGVSIAQHSECAS------SPQVLGDTIN---ELLP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaggt-IINP_524894.1 GGTase-II 29..315 CDD:239224 84/269 (31%)
PLN03201 33..340 CDD:215630 89/294 (30%)
CG17565NP_650540.1 PLN02710 27..403 CDD:215380 92/301 (31%)
FTase 62..360 CDD:239223 84/269 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438458
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1042804at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11774
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.