DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaggt-II and Y48E1B.3

DIOPT Version :9

Sequence 1:NP_524894.1 Gene:betaggt-II / 47757 FlyBaseID:FBgn0028970 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001254398.2 Gene:Y48E1B.3 / 174999 WormBaseID:WBGene00013002 Length:642 Species:Caenorhabditis elegans


Alignment Length:43 Identity:18/43 - (41%)
Similarity:21/43 - (48%) Gaps:3/43 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 FSFCAVASLTLLGRMEQTIDVEKAVKFVLSCCNQTDGGFGSKP 199
            |:| ||.|.|....:|||:.|......|..|..  .|||.|||
 Worm   235 FNF-AVKSFTESELLEQTLAVVDFGGRVWICGG--GGGFSSKP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaggt-IINP_524894.1 GGTase-II 29..315 CDD:239224 18/43 (42%)
PLN03201 33..340 CDD:215630 18/43 (42%)
Y48E1B.3NP_001254398.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1042804at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.