DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaggt-II and rabggtb

DIOPT Version :9

Sequence 1:NP_524894.1 Gene:betaggt-II / 47757 FlyBaseID:FBgn0028970 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001106636.1 Gene:rabggtb / 100127877 XenbaseID:XB-GENE-953600 Length:331 Species:Xenopus tropicalis


Alignment Length:312 Identity:201/312 - (64%)
Similarity:254/312 - (81%) Gaps:3/312 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KHVEYIENHGKQEDDYEYCMTEFLRMSGIYWGTTALDIMGQLERLERKSIIEFVKRCQCPNTGGF 97
            ||.:|||::|.::|||||||:|:|||||||||.|.:|:||:|:|:.::.|:.|:|.|| .:.|||
 Frog    22 KHAQYIESYGAKKDDYEYCMSEYLRMSGIYWGLTVMDLMGELQRMNKEEILAFIKSCQ-HDCGGF 85

  Fly    98 APCEGHDPHLLYTLSAIQILCTYDALEEIDREAVVRFVVGLQQPDGSFFGDKWGEVDTRFSFCAV 162
            :...||||||||||||:|||..||:|..:|...:|.:|..||:.||||.||||||:|||||||||
 Frog    86 SASIGHDPHLLYTLSAVQILTLYDSLSAVDSNRIVDYVQSLQKEDGSFAGDKWGEIDTRFSFCAV 150

  Fly   163 ASLTLLGRMEQTIDVEKAVKFVLSCCNQTDGGFGSKPGAESHAGLIYCCVGFFSLTHRLHLLDVD 227
            |:|.||||:: .|::|||::|||||.| .|||||.:||:|||||.||||.||.::|.:||.::.|
 Frog   151 ATLALLGRLD-AINIEKAIEFVLSCMN-FDGGFGCRPGSESHAGQIYCCTGFLAITDQLHQVNAD 213

  Fly   228 KLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLTIMGRLHWISSEKLQQFILSCQDTETGGF 292
            .|||||||||||||||||||||||||||||||||||.|:||||||..|||:.|:|:|||.|||||
 Frog   214 LLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRLFVLACQDEETGGF 278

  Fly   293 SDRTGNMPDIFHTLFGIGGLSLLGHSGLKAINPTLCMPQYIIDRLGIKPQLL 344
            :||.|:|.|.|||||||.||||||...:|.:||..|||:.|:.|:.|:|:|:
 Frog   279 ADRPGDMVDPFHTLFGIAGLSLLGEERIKPVNPVFCMPEEILQRINIQPELV 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaggt-IINP_524894.1 GGTase-II 29..315 CDD:239224 187/281 (67%)
PLN03201 33..340 CDD:215630 198/306 (65%)
rabggtbNP_001106636.1 PLN03201 17..323 CDD:215630 197/303 (65%)
GGTase-II 18..301 CDD:239224 187/281 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3371
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1042804at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11774
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R919
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.140

Return to query results.
Submit another query.