DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12253 and AT5G35695

DIOPT Version :10

Sequence 1:NP_652056.2 Gene:CG12253 / 47730 FlyBaseID:FBgn0026148 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_680341.1 Gene:AT5G35695 / 833543 AraportID:AT5G35695 Length:211 Species:Arabidopsis thaliana


Alignment Length:81 Identity:20/81 - (24%)
Similarity:26/81 - (32%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 FRGRILLGNEMVRCSSSLFTPVRFPRNQSEELYNHAHAVTYASARKCLNLLMSRFGILATEIQGS 313
            |||        ||.....|...|.......||:|..|........:...:..|||.|..:....|
plant    66 FRG--------VRYHLQEFAGQRRDPETPHELFNLRHVSLRNVIERIFGIFKSRFAIFKSAPPFS 122

  Fly   314 HGSAKQTITALAILHN 329
            :......:...|.|||
plant   123 YKKQAGLVLTCAALHN 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12253NP_652056.2 DDE_Tnp_4 203..329 CDD:463855 18/79 (23%)
AT5G35695NP_680341.1 DDE_Tnp_4 <24..138 CDD:463855 18/79 (23%)

Return to query results.
Submit another query.