DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12253 and AT5G28950

DIOPT Version :10

Sequence 1:NP_652056.2 Gene:CG12253 / 47730 FlyBaseID:FBgn0026148 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_198247.1 Gene:AT5G28950 / 833021 AraportID:AT5G28950 Length:148 Species:Arabidopsis thaliana


Alignment Length:110 Identity:23/110 - (20%)
Similarity:39/110 - (35%) Gaps:46/110 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QRFQRSLKDFDYFKDFQCFLNIKHNSRARATHI-----KKRNPRF-NPLTDLNEHKFRLKYRYTK 63
            ::.:.|.:.:.||||  |...|..      |||     :|:.|.| |...|::::          
plant    10 RKIRESTRLYPYFKD--CVGAIDD------THIFAMVSQKKMPSFRNRKGDISQN---------- 56

  Fly    64 ENLRRIIEIVRDDLEIEYFEPLKREQVPIDLQILSAIRLWGGTEH 108
                 ::.....|:|..|              :||.   |.|:.|
plant    57 -----MLAACNFDVEFMY--------------VLSG---WEGSAH 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12253NP_652056.2 DDE_Tnp_4 203..329 CDD:463855
AT5G28950NP_198247.1 DDE_Tnp_4 29..>86 CDD:463855 17/89 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.