DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12253 and AT4G10890

DIOPT Version :10

Sequence 1:NP_652056.2 Gene:CG12253 / 47730 FlyBaseID:FBgn0026148 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_567367.1 Gene:AT4G10890 / 826688 AraportID:AT4G10890 Length:527 Species:Arabidopsis thaliana


Alignment Length:77 Identity:17/77 - (22%)
Similarity:29/77 - (37%) Gaps:25/77 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 RDLDIRLIDEQSMLTDTEMFGLSKIKDRFEQNEFRGRILLGNEMVRCSSSLFTPVRFPRNQSEEL 280
            :.||:|.:.:::       ||:.|.|.|...:             .|.:     |....|.::..
plant   138 KHLDLRSVIDRT-------FGVWKAKWRILDH-------------TCKN-----VNIAINVTKTN 177

  Fly   281 YNHAHAVTYASA 292
            .|||.|.|..:|
plant   178 INHASATTVTAA 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12253NP_652056.2 DDE_Tnp_4 203..329 CDD:463855 17/77 (22%)
AT4G10890NP_567367.1 DDE_Tnp_4 <72..160 CDD:463855 8/28 (29%)
DUF2439 245..314 CDD:463065
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.