DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL4A and AT1G77550

DIOPT Version :9

Sequence 1:NP_001162947.1 Gene:TTLL4A / 47729 FlyBaseID:FBgn0026147 Length:1071 Species:Drosophila melanogaster
Sequence 2:NP_177879.3 Gene:AT1G77550 / 844091 AraportID:AT1G77550 Length:855 Species:Arabidopsis thaliana


Alignment Length:638 Identity:151/638 - (23%)
Similarity:228/638 - (35%) Gaps:153/638 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 RDNSEDRTWQGQKYEKHVLKEKLPS-NDLKADYLDNGWGGDPGSEDDYRDIKDSYDPVVVIDNGL 332
            |.||.|:...|:..|  ||| ..|| :.|:.|.        ||             |:.:  |.|
plant   295 RGNSLDQNSVGELLE--VLK-LFPSLSSLEVDI--------PG-------------PLGI--NAL 333

  Fly   333 EQVGVHRRYCRMTENTVLDGSGDTLINNNNNELKIM---RKSTDQPM-PRLP-MTPKRAKGGTVS 392
            |               :|:...:..:.|..:..||:   :...|..: ||:| :.|...      
plant   334 E---------------ILESLSNLSLLNGVDTAKILETGKHVVDSMLQPRIPELNPDDT------ 377

  Fly   393 TKKPMPTVHRVL----LYSTQSPRLGRKQQFSTQRLSVKQQSSKVLGAGDE---RQTVLLLEPEH 450
                  .|.|||    ||:........::...|....|..:....|...||   :....|..|..
plant   378 ------LVDRVLDAMWLYALNYRLADDEKLDETSLWYVMDELGSALRHSDEPNFKVAPFLFMPSG 436

  Fly   451 KQEDHRSAIDFD-----RNDDFDEDDDLDNLSNFDE----SDTASVLSDTEDGYRAHAF-----K 501
            |.|   ||:.:.     ::....::...|.||...|    |...:....|.:.|..|.|     |
plant   437 KLE---SAVSYSVMWPIKHSQKGDECTRDFLSGIGEDKQRSARLTAWFQTPENYFIHEFEKYQQK 498

  Fly   502 LTHSVDRFSSPQSTPSFLSSQSSEDDLKNPDSLLVPSLFPYVPPYLSFSSNTKRGPRVPPDLHRV 566
            |  ....|.|..|.||...|....|.    ..|||.:..|.|..:|:           .|:    
plant   499 L--QAKAFESKPSNPSVSRSIQHSDG----SPLLVYTDLPQVEEFLT-----------RPE---- 542

  Fly   567 LKWRITNIMPKVVRLILANSGMRMLKKTNDWMGVW-GKHLKSPCFKAIRSYQKINHLPGSFRIGR 630
              :.||| .||...::              |..|. ...||...  .|...|.||..|....:..
plant   543 --FVITN-EPKDADIL--------------WTSVQVDDELKKEV--GITDDQYINQFPFEACLVM 588

  Fly   631 KDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDLGALRRHW--PKYAQRNTKWIIKPPASARGAGI 693
            |....:.:  |||..|.|   ::..||.:...|......:  .|..|.|..||:||...||....
plant   589 KHHLAETI--QMGYGSPK---WLQPTYNLETQLSQFIGDYCVRKRDQLNNLWILKPWNMARTIDT 648

  Fly   694 RVINRWGQIPKRR---PLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVK 755
            .:.:....|.:..   |.|.|||||.|.|..|:|||||..|||.|::||.:::......|.::..
plant   649 SITDNLSAIIRMMETGPKICQKYIEHPALFKGNKFDLRYVVLVRSIDPLEIYLIEIFWVRLSNNP 713

  Fly   756 YSAKTDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEALR 820
            ||.:..:..:...|.|       ..||.:..:      ||.|.:.:..:.....|:...:.|.::
plant   714 YSLEKHSFFEYETHFT-------VMNYGRKLN------HKPTAEFVREFEQEHNVKWMDIHEKVK 765

  Fly   821 SLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISP 873
            . |:|.:....    ::....::|..| ..::|.||:|||...|.:|||...|
plant   766 Q-VIRAVFEAA----ALAHPEMQSPKS-RAMYGVDVMLDSSFEPKILEVTYCP 812

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL4ANP_001162947.1 TTL 614..908 CDD:281171 71/265 (27%)
AT1G77550NP_177879.3 leucine-rich repeat 142..163 CDD:275380
LRR_RI <147..314 CDD:238064 9/21 (43%)
leucine-rich repeat 168..193 CDD:275380
leucine-rich repeat 194..222 CDD:275380
leucine-rich repeat 263..288 CDD:275380
leucine-rich repeat 289..319 CDD:275380 11/26 (42%)
ATP-grasp_4 574..827 CDD:302634 71/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.