DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL4A and Ttll7

DIOPT Version :9

Sequence 1:NP_001162947.1 Gene:TTLL4A / 47729 FlyBaseID:FBgn0026147 Length:1071 Species:Drosophila melanogaster
Sequence 2:NP_001289886.1 Gene:Ttll7 / 70892 MGIID:1918142 Length:912 Species:Mus musculus


Alignment Length:493 Identity:154/493 - (31%)
Similarity:242/493 - (49%) Gaps:80/493 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   560 PPDLHRVLKWRITNIMPKVVR------LILAN---SGMRMLKKTNDWMGVWGKHLKSP------- 608
            |.||...|.::.|  |.:.||      :|.||   :...:::...|.||    .:|:|       
Mouse    15 PVDLGTELPYQCT--MKRKVRKKKKKGIITANVAGTKFEIVRLVIDEMG----FMKTPDEDETSN 73

  Fly   609 ---CFKAI--------RSYQKINHLPGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPND 662
               |..|:        ::||:|||.||...|.|||...:|:.: |.|....::.|:|||:|.|::
Mouse    74 LIWCDAAVQQEKITDLQNYQRINHFPGMGEICRKDFLARNMTK-MIKSRPMDYTFVPRTWIFPSE 137

  Fly   663 LGALRRHWP--KYAQRNTKWIIKPPASARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGSKF 725
            ....:.:..  |..::...:|:||...|.|.||.:|....::|.:..||||:|||:|.|:.|.||
Mouse   138 YTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKVPSQDHLIVQEYIEKPFLMEGYKF 202

  Fly   726 DLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDT-LNDRCMHLTNYSINKFSSNYSKNEDVN 789
            |||:|:||||.:||::|:||:||.|..:.||....:: |....|||||||:||.:..:.:||..:
Mouse   203 DLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNERFERNETED 267

  Fly   790 ACHGHKWTIKSLWTYL-ANRGVRTDCLWEALRSLVLRTILAGENGI---NSMIRANVE--SKYSC 848
              .|.|.:||....:| ||:...|. .|..:..||::|::..|..:   ..|.|....  |:..|
Mouse   268 --KGSKRSIKWFTEFLQANQHDVTK-FWSDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVC 329

  Fly   849 FELFGFDVILDSDLVPWLLEVNISPSLHSELPLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKEL 913
            ||:.|||::||..|.|||||:|.:||..::..:|..||    :|||..||..:..:.| ||:|.|
Mouse   330 FEVLGFDILLDRKLKPWLLEINRAPSFGTDQKIDYDVK----RGVLLNALKLLNIRTS-DKRKNL 389

  Fly   914 AAEFS--------------FPPGTQMCYDKRLYINYLSREEKIKHNTFTRKSMEDRNEYVDAILN 964
            |.:.:              ..||:.....:|..:.  .|:|::|......:....:.|:.:..:.
Mouse   390 AKQKAEAQRRLYGQNPVRRLSPGSSDWEQQRHQLE--RRKEELKERLLQVRKQVSQEEHENRHMG 452

  Fly   965 N----LTPDDVRCLIIAEDELA---------RCAPLER 989
            |    ..|:|...|...|..||         |.|..:|
Mouse   453 NYRRIYPPEDKALLEKYEGLLAVAFQTFLSGRAASFQR 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL4ANP_001162947.1 TTL 614..908 CDD:281171 114/302 (38%)
Ttll7NP_001289886.1 TTL 91..376 CDD:281171 112/292 (38%)
c-MTBD region. /evidence=ECO:0000250|UniProtKB:Q6ZT98 388..450 9/63 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 547..570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 658..688
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D250453at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.