DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL4A and Ttll7

DIOPT Version :9

Sequence 1:NP_001162947.1 Gene:TTLL4A / 47729 FlyBaseID:FBgn0026147 Length:1071 Species:Drosophila melanogaster
Sequence 2:XP_038959801.1 Gene:Ttll7 / 310982 RGDID:1566117 Length:886 Species:Rattus norvegicus


Alignment Length:487 Identity:157/487 - (32%)
Similarity:242/487 - (49%) Gaps:76/487 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   560 PPDLHRVLKWRITNIMPKVVR------LILAN---SGMRMLKKTNDWMGVWGKHLKSP------- 608
            |.:|:..|.:..|  |.:.||      :|.||   :...:::...|.||    .:|:|       
  Rat    15 PLELNTELPYHCT--MKRKVRKKKKKGIITANVAGTKFEIVRLVIDEMG----FIKTPDEDETSN 73

  Fly   609 ---CFKAI--------RSYQKINHLPGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPND 662
               |..|:        ::||:|||.||...|.|||...:|:.: |.|....::.|:|||:|.|::
  Rat    74 LIWCDAAVQQEKITDLQNYQRINHFPGMGEICRKDFLARNMTK-MIKSRPMDYTFVPRTWIFPSE 137

  Fly   663 LGALRRHWP--KYAQRNTKWIIKPPASARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGSKF 725
            ....:.:..  |..::...:||||...|.|.||.:|....:||.:..||||:|||:|.|:.|.||
  Rat   138 YTQFQNYVKELKKKRKQKTFIIKPANGAMGHGISLIRNGDKIPSQDHLIVQEYIEKPFLMEGYKF 202

  Fly   726 DLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDT-LNDRCMHLTNYSINKFSSNYSKNEDVN 789
            |||:|:||||.:||::|:||:||.|..:.||....:: |....|||||||:||.:..:.:||..:
  Rat   203 DLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNERFERNETED 267

  Fly   790 ACHGHKWTIKSLWTYL-ANRGVRTDCLWEALRSLVLRTILAGENGI---NSMIRANVE--SKYSC 848
              .|.|.:||....:| ||:...|. .|..:..||::|::..|..:   ..|.|....  |:..|
  Rat   268 --KGSKRSIKWFTEFLQANQHDVTK-FWSDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVC 329

  Fly   849 FELFGFDVILDSDLVPWLLEVNISPSLHSELPLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKEL 913
            ||:.|||::||..|.|||||:|.:||..::..:|..||    :|||..||..:..:.| ||:|.|
  Rat   330 FEVLGFDILLDRKLKPWLLEINRAPSFGTDQKIDYDVK----RGVLLNALKLLNIRTS-DKRKNL 389

  Fly   914 AAEFSFPPGTQMCYDKRLY----INYLSRE----EKIKHNTFTRKSMEDRNEYVDAILNNLTPDD 970
            |.:       :....:|||    |..||..    |:.:|....||  |:..|.:..:...::.: 
  Rat   390 AKQ-------KAEAQRRLYGQNPIRRLSPGSSDWEQQRHQLERRK--EELKERLLQVRKQISQE- 444

  Fly   971 VRCLIIAEDELARCAPLERIFPTDQTHKYLKY 1002
                   |.|........||:|.:......||
  Rat   445 -------EHENRHMGNYRRIYPPEDKTLLEKY 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL4ANP_001162947.1 TTL 614..908 CDD:281171 116/302 (38%)
Ttll7XP_038959801.1 TTL 91..376 CDD:397308 114/292 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D250453at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.