DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL4A and Ttll2

DIOPT Version :9

Sequence 1:NP_001162947.1 Gene:TTLL4A / 47729 FlyBaseID:FBgn0026147 Length:1071 Species:Drosophila melanogaster
Sequence 2:XP_006227981.1 Gene:Ttll2 / 292311 RGDID:1305200 Length:541 Species:Rattus norvegicus


Alignment Length:388 Identity:126/388 - (32%)
Similarity:185/388 - (47%) Gaps:62/388 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   567 LKWRITNIMPKVVRLILANSGM----RMLKKTNDWMGVWGKHLKSPCFKA-----IRSYQKINHL 622
            |.:|:....|.||:.:|...|.    ...:...||...|    :|..|:.     |:.:|::||.
  Rat    45 LVFRVDESTPGVVQSVLLERGWDKFDEQCQDVEDWNLYW----RSSSFRMAEYVNIKPWQRLNHH 105

  Fly   623 PGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDLGA-LRRHWPKYAQRNTK---WIIK 683
            ||:..:.|||...|:|......:....:.|.|.|:|:|:|... :.:::.:.....||   ||.|
  Rat   106 PGTTSLTRKDCLAKHLAHMRRLYGESIYEFTPLTFIMPSDYTKFVAKYFKEKQDLGTKPSYWICK 170

  Fly   684 PPASARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGL 748
            |...::|.||.:.:....:..:...:|||||..|||:...|.|||:||.||...||.::||..||
  Rat   171 PAKLSQGRGIIIFSDIRDLMFKDAYVVQKYICNPLLVGRYKCDLRIYVCVTGFKPLTIYMYQEGL 235

  Fly   749 ARFASVKYSAKTDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTD 813
            .|||:.|:.  ...|.|...||||.||||..::|.|.::| ...|.|||:...::||.|..|...
  Rat   236 VRFATEKFD--LSNLEDYYSHLTNSSINKLGASYEKIKEV-VGQGCKWTLSRFFSYLRNWDVDDL 297

  Fly   814 CLWEALRSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSE 878
            .|...:..:|:.|:||        :..:|....:||||||||:::|.:|.|||||||.||:|..|
  Rat   298 LLRRKINHMVILTVLA--------MAPSVPVANNCFELFGFDILIDDNLKPWLLEVNYSPALSLE 354

  Fly   879 LPLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSREEK 941
            ...|..||..||..::                 ||                 ||:|.|..|||
  Rat   355 CSTDVSVKRSLVHDII-----------------EL-----------------LYLNGLRSEEK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL4ANP_001162947.1 TTL 614..908 CDD:281171 104/297 (35%)
Ttll2XP_006227981.1 TTL 98..371 CDD:281171 104/300 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D250453at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.