DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL4A and ttll-15

DIOPT Version :10

Sequence 1:NP_723642.2 Gene:TTLL4A / 47729 FlyBaseID:FBgn0026147 Length:1071 Species:Drosophila melanogaster
Sequence 2:NP_505663.3 Gene:ttll-15 / 187090 WormBaseID:WBGene00010630 Length:513 Species:Caenorhabditis elegans


Alignment Length:110 Identity:23/110 - (20%)
Similarity:33/110 - (30%) Gaps:40/110 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 STFEQLLRFQGAFPRQLSLSRSFASIVSTLAIQMDQERSNFTVGANAPVVLVFAQSHRIANADFE 74
            :.|..:|.|..  |:...|.|.:.:|.|      |.|..|  |.|:|        .|.:.:|   
 Worm   242 ANFSHMLGFDS--PQMKELMRLYVTIHS------DHEGGN--VSAHA--------GHLVGSA--- 285

  Fly    75 SARRMLRGSFEQFPDLYFAFVTNDGATFRQLTNFTGTTHSRSADE 119
                        ..|.|.:|..       .|....|..|..:..|
 Worm   286 ------------LSDPYLSFAA-------ALNGLAGPLHGLANQE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL4ANP_723642.2 TTL 614..909 CDD:397308
ttll-15NP_505663.3 CPSase_L_D2 133..411 CDD:473076 23/110 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.