DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL4A and TTLL11

DIOPT Version :9

Sequence 1:NP_001162947.1 Gene:TTLL4A / 47729 FlyBaseID:FBgn0026147 Length:1071 Species:Drosophila melanogaster
Sequence 2:NP_001132914.2 Gene:TTLL11 / 158135 HGNCID:18113 Length:710 Species:Homo sapiens


Alignment Length:432 Identity:126/432 - (29%)
Similarity:209/432 - (48%) Gaps:85/432 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   618 KINHLPGSFRIGRKDSCWKNLQRQMGKHSN---KEFGFMPRTYIIPNDLGALRRHWPKYAQRNTK 679
            ::|..||...:.||.:    |.|.:....|   :|:.|.||::|:|::..............:..
Human   181 QVNKFPGMTEMVRKIT----LSRAVRTMQNLFPEEYNFYPRSWILPDEFQLFVAQVQMVKDDDPS 241

  Fly   680 W----IIKPPASARGAGIRVIN-----RWGQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTS 735
            |    |:||....:|.||.:|.     |.....:.||.:||:||.:||||:..|||:|||||:.|
Human   242 WKPTFIVKPDGGCQGDGIYLIKDPSDIRLAGTLQSRPAVVQEYICKPLLIDKLKFDIRLYVLLKS 306

  Fly   736 VNPLRVFMYHNGLARFASVKYSAKT-DTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIK 799
            ::||.:::..:||:||.:..|...| ..|:...|||||||:|..|.|:..::  :|..|.|.|..
Human   307 LDPLEIYIAKDGLSRFCTEPYQEPTPKNLHRIFMHLTNYSLNIHSGNFIHSD--SASTGSKRTFS 369

  Fly   800 SLWTYLANRGVRTDCLWEALRSLVLRTILAGENGINSMIRANVESKY---SCFELFGFDVILDSD 861
            |:...|:::||....:|..:.|:|::|::|....:....::::.:..   :||::.|||::|..:
Human   370 SILCRLSSKGVDIKKVWSDIISVVIKTVIALTPELKVFYQSDIPTGRPGPTCFQILGFDILLMKN 434

  Fly   862 LVPWLLEVNISPSLHSELPLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKELAAEFSFPPGTQMC 926
            |.|.|||||.:||:..|   ..|..:|   ||..    |||.  .:|::.::|          :.
Human   435 LKPILLEVNANPSMRIE---HEHELSP---GVFE----NVPS--LVDEEVKVA----------VI 477

  Fly   927 YDKRLYINYLSREEKIKHNTFTRKSMEDRNEYV--------DAILNNLT--PDDVRCLIIAEDEL 981
            .|....::.|            :|..|::::.:        ||:...||  ||   |....|..|
Human   478 RDTLRLMDPL------------KKKRENQSQQLEKPFAGKEDALDGELTSAPD---CNANPEAHL 527

  Fly   982 ARCAPLERIFPTDQTHKYLK-YNDTPRYYNRLLDAWESRYAN 1022
            .... |:::||     ||.| :|     |.||:|    |.||
Human   528 PSIC-LKQVFP-----KYAKQFN-----YLRLVD----RMAN 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL4ANP_001162947.1 TTL 614..908 CDD:281171 97/305 (32%)
TTLL11NP_001132914.2 CPSase_L_D2 181..482 CDD:418439 100/328 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D250453at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.