DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL4A and Ttll2

DIOPT Version :9

Sequence 1:NP_001162947.1 Gene:TTLL4A / 47729 FlyBaseID:FBgn0026147 Length:1071 Species:Drosophila melanogaster
Sequence 2:XP_011244473.1 Gene:Ttll2 / 100216474 MGIID:3644030 Length:551 Species:Mus musculus


Alignment Length:487 Identity:140/487 - (28%)
Similarity:213/487 - (43%) Gaps:100/487 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   567 LKWRITNIMPKVVRLILANSGMRMLKKTNDWMGVWGKHLKSPCFKA-----IRSYQKINHLPGSF 626
            |.:|:....|.:|:.:|...|.....:....:..|..:.:|..|:.     ::.:|::||.||..
Mouse    55 LVFRVDESTPGLVQSVLLERGWDKFDEQRQDVEDWNLYWRSSSFRRAEYVNVKPWQRLNHHPGMT 119

  Fly   627 RIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDLGA-LRRHWPKYAQRNTK---WIIKPPAS 687
            .:.|||...|:|.|...::....:.|.|.|:|:|.|... :.:::.:.....||   ||.||...
Mouse   120 NLTRKDCLAKHLARMRSRYGESLYEFTPLTFIMPTDYTKFVAKYFKEKQDLGTKPSYWICKPAEL 184

  Fly   688 ARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFA 752
            :||.||.:.:....:..:...:|||||..|||:...|.|||:||.:|...||.::||..||.|||
Mouse   185 SRGRGIIIFSDIRDLMFKGTYVVQKYICNPLLVGRYKCDLRIYVCITGFKPLTIYMYQEGLVRFA 249

  Fly   753 SVKYSAKTDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWE 817
            :.|:..:  .|.|...||||.||||..::|.|.::| ...|.|||:...::||.|..|....|.:
Mouse   250 TEKFDLR--NLEDYYSHLTNSSINKLGASYQKIKEV-VGQGCKWTLSRFFSYLRNWDVDDLLLRQ 311

  Fly   818 ALRSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSELPLD 882
            .:..:|:.|:||        :..:|...|:||||||||:::|.:|.|||||||.:|:|..:...|
Mouse   312 KISHMVILTVLA--------MAPSVPVTYNCFELFGFDILIDDNLKPWLLEVNYNPALTLDCSTD 368

  Fly   883 AHVKAPLVQGVLNTALYNVPPKLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSREEK------ 941
            ..||..||..|:                 ||                 ||:|.|..|||      
Mouse   369 ESVKRSLVHDVI-----------------EL-----------------LYLNGLRSEEKKCGRTS 399

  Fly   942 ----------IKHNTF----TRKSMEDRNEYV-----DAILNNLTPDDVRCLIIAE--------- 978
                      ..|:.|    ...|.....|:.     |..:.|:.|...|...:.|         
Mouse   400 PGNSVVSLARSHHHEFCATPNSSSYASLIEFTTGSKSDPAVQNICPKHTRTSQLREMMSRRDRLL 464

  Fly   979 -DELARCAPLER--------IFP---TDQTHK 998
             .|.|:..|..:        :||   ..|.||
Mouse   465 TKEAAKSKPRHKAWHLPRKMVFPYASQSQPHK 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL4ANP_001162947.1 TTL 614..908 CDD:281171 105/297 (35%)
Ttll2XP_011244473.1 TTL 108..381 CDD:281171 105/300 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D250453at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.