DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and ZNF561

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_024307548.1 Gene:ZNF561 / 93134 HGNCID:28684 Length:502 Species:Homo sapiens


Alignment Length:450 Identity:101/450 - (22%)
Similarity:167/450 - (37%) Gaps:100/450 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CGWRDCQEICTGEWSLNGHI-----GDHLEHYAKAQDDRGAHAEHTEHQ--CTWNSCDFRTENQV 84
            |..::|.|:...::.|..|:     |:..|.....:|....|.|.:..|  ..:|.|        
Human   134 CDCKNCGEVFREQFCLKTHMRVQNGGNTSEGNCYGKDTLSVHKEASTGQELSKFNPC-------- 190

  Fly    85 EFERHSYYHGYYLNLLLQGKLECDLHPEIPACTAPARLMEKLPALGQNFRCGWTDCEREFVSIVE 149
                              ||: ..|.|.:      |..:|.|.| .|.::|  .:|.:.|.....
Human   191 ------------------GKV-FTLTPGL------AVHLEVLNA-RQPYKC--KECGKGFKYFAS 227

  Fly   150 FQDHIVKHALFEYDIQKTPEDERPKTMCNWAMCHKHMGNKYRLIEHISTHSNKKQVACFHCGELF 214
            ..:|:..|.           ||:   :|.:....:.:.....|.:.::.|:.||......||:.|
Human   228 LDNHMGIHT-----------DEK---LCEFQEYGRAVTASSHLKQCVAVHTGKKSKKTKKCGKSF 278

  Fly   215 RTKTTLFDHLRRQPENNTNSFQCAQCFKFFATKKLLKSHVVRH--VNCYKCTMCDMTCSSASSLT 277
            ...:.|:..::  ......||:|.:|.:.|.....|..|:..|  :..:|||.|....:.::.||
Human   279 TNFSQLYAPVK--THKGEKSFECKECGRSFRNSSCLNDHIQIHTGIKPHKCTYCGKAFTRSTQLT 341

  Fly   278 THIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEHPDCHYSVRTYTQMRRHFLEV 342
            .|:| .|...||.:|.||.....:.|.|:.|::....|..:||:  :|..:..|.|.:.:| ..:
Human   342 EHVR-THTGIKPYECKECGQAFAQYSGLSIHIRSHSGKKPYQCK--ECGKAFTTSTSLIQH-TRI 402

  Fly   343 H-GNNPILYACHCCERFFKSGKSLSAHLMKKHGFRLPSGHKRFTYRVDENGFYRLETTRLESLEV 406
            | |..|  |.|..|.:.|.:....|.|| |.|     ||.|.|..::....|             
Human   403 HTGEKP--YECVECGKTFITSSRRSKHL-KTH-----SGEKPFVCKICGKAF------------- 446

  Fly   407 TQQILSPQVNDSLAKPGTGS----CYE-----IVDPTNTEFERIIVSNDPNEAQLMGEVV 457
               :.|.::|..| :..||.    |.|     .|....:..|||.....|.|.:.|...:
Human   447 ---LYSSRLNVHL-RTHTGEKPFVCKECGKAFAVSSRLSRHERIHTGEKPYECKDMSVTI 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 1/16 (6%)
C2H2 Zn finger 207..225 CDD:275368 4/17 (24%)
C2H2 Zn finger 237..257 CDD:275368 5/19 (26%)
C2H2 Zn finger 263..284 CDD:275368 7/20 (35%)
C2H2 Zn finger 292..311 CDD:275368 6/18 (33%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
ZNF561XP_024307548.1 KRAB 56..96 CDD:307490
C2H2 Zn finger 190..207 CDD:275370 7/49 (14%)
C2H2 Zn finger 215..235 CDD:275368 4/21 (19%)
C2H2 Zn finger 243..263 CDD:275368 1/19 (5%)
COG5048 <287..483 CDD:227381 57/226 (25%)
C2H2 Zn finger 299..319 CDD:275368 5/19 (26%)
C2H2 Zn finger 327..347 CDD:275368 7/20 (35%)
C2H2 Zn finger 355..375 CDD:275368 6/19 (32%)
C2H2 Zn finger 383..403 CDD:275368 5/22 (23%)
C2H2 Zn finger 411..431 CDD:275368 7/20 (35%)
C2H2 Zn finger 439..459 CDD:275368 4/36 (11%)
C2H2 Zn finger 467..487 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.