DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and ZNF764

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_219363.2 Gene:ZNF764 / 92595 HGNCID:28200 Length:408 Species:Homo sapiens


Alignment Length:378 Identity:86/378 - (22%)
Similarity:134/378 - (35%) Gaps:81/378 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KPAELELTCGWRDCQEICTGEWSLNGHIGDH-------LEHYAKAQDDRGAHAEHTEHQCTWNSC 76
            :||:..|   :||......|..|..| ||.:       :|..|:.........|..:.|...:..
Human    44 RPAQRAL---YRDVMRETYGHLSALG-IGGNKPALISWVEEEAELWGPAAQDPEVAKCQTQTDPA 104

  Fly    77 DFRTENQVEFERHSYYHGYYLNLLLQGKLECDLHPEIPACTAPARLMEKLPALGQNFRCGWTDCE 141
            |.|.:.: |.:|..           .|.||   .|:..|..:|.....:.|:.|..:  ||.   
Human   105 DSRNKKK-ERQREG-----------TGALE---KPDPVAAGSPGLKSPQAPSAGPPY--GWE--- 149

  Fly   142 REFVSIVEFQDHIVKHALFEYDIQKTPEDERPKTMCNWAMCHKHMGNKYRLIEHISTHSNKKQVA 206
                                 .:.|.|...||.                 |..|.......::..
Human   150 ---------------------QLSKAPHRGRPS-----------------LCAHPPVPRADQRHG 176

  Fly   207 CFHCGELFRTKTTLFDHLRRQPENNTNSFQCAQCFKFFATKKLLKSH--VVRHVNCYKCTMCDMT 269
            |:.||:.|..::||.:|:  ........|.|..|.|.|.....|..|  :.|....::|..|...
Human   177 CYVCGKSFAWRSTLVEHV--YSHTGEKPFHCTDCGKGFGHASSLSKHRAIHRGERPHRCLECGRA 239

  Fly   270 CSSASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEHPDCHYSVRTYTQ 334
            .:..|:||:|:|. |..:||..|::|..|..:.|.|.:|.::...:|...|  |||..:....:.
Human   240 FTQRSALTSHLRV-HTGEKPYGCADCGRRFSQSSALYQHRRVHSGETPFPC--PDCGRAFAYPSD 301

  Fly   335 MRRHFLEVHGNNPILYACHCCERFFKSGKSLSAHLMKKHG---FRLPSGHKRF 384
            :|||.....|..|  |.|..|.|.|:....::||.....|   :..|...:||
Human   302 LRRHVRTHTGEKP--YPCPDCGRCFRQSSEMAAHRRTHSGEKPYPCPQCGRRF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 2/16 (13%)
C2H2 Zn finger 207..225 CDD:275368 7/17 (41%)
C2H2 Zn finger 237..257 CDD:275368 6/21 (29%)
C2H2 Zn finger 263..284 CDD:275368 7/20 (35%)
C2H2 Zn finger 292..311 CDD:275368 6/18 (33%)
C2H2 Zn finger 352..373 CDD:275368 6/20 (30%)
ZNF764NP_219363.2 zf-H2C2_2 301..326 CDD:290200 10/26 (38%)
C2H2 Zn finger 317..337 CDD:275368 6/19 (32%)
zf-H2C2_2 333..352 CDD:290200 3/18 (17%)
C2H2 Zn finger 345..365 CDD:275368 3/8 (38%)
KRAB 26..85 CDD:214630 12/44 (27%)
KRAB 26..65 CDD:279668 7/23 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..167 22/133 (17%)
C2H2 Zn finger 177..197 CDD:275368 7/21 (33%)
zf-H2C2_2 190..212 CDD:290200 6/23 (26%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
zf-H2C2_2 217..242 CDD:290200 5/24 (21%)
COG5048 229..>294 CDD:227381 21/67 (31%)
C2H2 Zn finger 233..253 CDD:275368 7/20 (35%)
zf-H2C2_2 245..270 CDD:290200 10/25 (40%)
C2H2 Zn finger 261..281 CDD:275368 6/19 (32%)
zf-H2C2_2 273..298 CDD:290200 7/26 (27%)
COG5048 285..>350 CDD:227381 19/68 (28%)
C2H2 Zn finger 289..309 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.