DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and ZNF251

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_612376.1 Gene:ZNF251 / 90987 HGNCID:13045 Length:671 Species:Homo sapiens


Alignment Length:421 Identity:94/421 - (22%)
Similarity:145/421 - (34%) Gaps:97/421 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KRKKPAELELTCGWRDCQEICTGEWSLNGHIGDHLEHYAKAQDDRGAHAEHTEHQCTWNSCDFRT 80
            :|.|..|....|      :||:..:..|..:..|          :.:|.....::|  ..|....
Human   200 QRNKTGERVFKC------DICSKTFKYNSDLSRH----------QRSHTGEKPYEC--GRCGRAF 246

  Fly    81 ENQVEFERHSYYHGYYLNLLLQGK--LECDLHPEIPACTAPARLMEKLPALGQNFRCGWTDCERE 143
            .:......|.:.|        .|.  .:||...:.....:..||..::....:.|.||  :|.:.
Human   247 THSSNLVLHHHIH--------TGNKPFKCDECGKTFGLNSHLRLHRRIHTGEKPFGCG--ECGKA 301

  Fly   144 FVSIVEFQDHIVKHALFEYDIQKTPEDERPKTMCNWAMCHKHMGNKYRLIEHISTHSNKKQVACF 208
            |........|.:.|.           .|:| ..||  .|.:......:|.:|...|:.:|...|.
Human   302 FSRSSTLIQHRIIHT-----------GEKP-YKCN--ECGRGFSQSPQLTQHQRIHTGEKPHECS 352

  Fly   209 HCGELFRTKTTLFDHLR----RQPENNTNSFQCAQCFKFFATKKLLKSHVVRHV--NCYKCTMCD 267
            |||:.|...::|..|.|    .:|.      :|.||.|.|:....|..|...|.  ..|.|..|.
Human   353 HCGKAFSRSSSLIQHERIHTGEKPH------KCNQCGKAFSQSSSLFLHHRVHTGEKPYVCNECG 411

  Fly   268 MTCSSASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEHPDCHYSVRTY 332
            ......|.||.|:|. |..:||..|:||.....|.|.|.:|.::...:..:||  .:|..:....
Human   412 RAFGFNSHLTEHVRI-HTGEKPYVCNECGKAFRRSSTLVQHRRVHTGEKPYQC--VECGKAFSQS 473

  Fly   333 TQMRRHFLEVH-GNNPILYACHCCERFFKSGKSLSAH---------LMKKHG------------F 375
            :|:..| ..|| |..|  |.|..|.:.|....:|..|         ..:|||            .
Human   474 SQLTLH-QRVHTGEKP--YDCGDCGKAFSRRSTLIQHQKVHSGETRKCRKHGPAFVHGSSLTADG 535

  Fly   376 RLPSGHK-------------RFTYRVDENGF 393
            ::|:|.|             |:|....|..|
Human   536 QIPTGEKHGRAFNHGANLILRWTVHTGEKSF 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 3/16 (19%)
C2H2 Zn finger 207..225 CDD:275368 7/17 (41%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 263..284 CDD:275368 7/20 (35%)
C2H2 Zn finger 292..311 CDD:275368 7/18 (39%)
C2H2 Zn finger 352..373 CDD:275368 5/29 (17%)
ZNF251NP_612376.1 KRAB 15..75 CDD:214630
C2H2 Zn finger 181..203 CDD:275368 1/2 (50%)
COG5048 207..635 CDD:227381 91/414 (22%)
C2H2 Zn finger 211..231 CDD:275368 5/35 (14%)
C2H2 Zn finger 239..259 CDD:275368 3/21 (14%)
C2H2 Zn finger 267..287 CDD:275368 4/19 (21%)
C2H2 Zn finger 295..315 CDD:275368 5/21 (24%)
C2H2 Zn finger 323..343 CDD:275368 5/21 (24%)
C2H2 Zn finger 351..371 CDD:275368 8/19 (42%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 407..427 CDD:275368 7/20 (35%)
C2H2 Zn finger 435..455 CDD:275368 7/19 (37%)
C2H2 Zn finger 463..483 CDD:275368 4/22 (18%)
C2H2 Zn finger 491..511 CDD:275368 5/19 (26%)
C2H2 Zn finger 568..588 CDD:275368
C2H2 Zn finger 596..616 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.