DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and ZNF479

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001357058.1 Gene:ZNF479 / 90827 HGNCID:23258 Length:524 Species:Homo sapiens


Alignment Length:425 Identity:97/425 - (22%)
Similarity:153/425 - (36%) Gaps:112/425 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRPQSSVP------APQPPGKRKKPAELELTCGWRDCQ--EICTGEWSLNGHIGDHLEHYAKAQD 58
            |:|:..:.      .|:..||          ||....|  :.|..       :|::..|      
Human    97 LQPEQGIKDSLQKVIPRTYGK----------CGHEKLQFKKCCKS-------VGEYEVH------ 138

  Fly    59 DRGAHAEHTEHQCTWNSCDFRTENQVEFERHSY----------------YHG-YYLNLLLQGKLE 106
             :|.::|       .|.|...|:|:: |:.|.|                |.| .:......||..
Human   139 -KGGYSE-------VNQCLSTTQNKI-FQTHKYVKVFGKFSNSNRDKTRYTGNKHFKCNKYGKSF 194

  Fly   107 CDL-----HPEIPACTAPARLMEKLPALGQNFRCGWTDCEREFVSIVEFQDHIVKHALFEYDIQK 166
            |.|     |..|       ...||      :::|  .:|.:.|........|.:.|.        
Human   195 CMLSHLNQHQVI-------HTREK------SYKC--KECGKSFNCSSNHTTHKIIHT-------- 236

  Fly   167 TPEDERPKTMCNWAMCHKHMGNKYRLIEHISTHSNKKQVACFHCGELFRTKTTLFDHLRRQPENN 231
               .|:| ..|.  .|.|.......|..|..||:.:|...|..||:.||..:.|.:|  ::....
Human   237 ---GEKP-YRCE--ECGKAFSWSANLTRHKRTHTGEKPYTCEECGQAFRRSSALTNH--KRIHTG 293

  Fly   232 TNSFQCAQCFKFFATKKLLKSHVVRHVN---CYKCTMCDMTCSSASSLTTHIRYRHLKDKPLKCS 293
            ...::|.:|.|.|:....|..|...|..   | :|..|....|.:|:||.|.|. |.::||..|.
Human   294 ERPYKCEECGKAFSVSSTLTDHKRIHTGEKPC-RCEECGKAFSWSSNLTRHKRI-HTREKPYACE 356

  Fly   294 ECDTRCVRESDLAKHVQIVHSKTVHQCEHPDCHYSVRTYTQMRRHFLEVH-GNNPILYACHCCER 357
            ||.......|:|.:|.:|...:..:.||  :|....|..:.:..| ..:| |..|  |.|..|.:
Human   357 ECGQAFSLSSNLMRHRRIHTGEKPYTCE--ECGQDFRRSSALTIH-KRIHTGERP--YKCEECGK 416

  Fly   358 FFKSGKSLSAHLMKKHGFRLPSGHKRFTYRVDENG 392
            .|....:|:.|.      |:.:|.:  .|:.:|.|
Human   417 VFSLSSTLTDHK------RIHTGER--PYKCEECG 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 4/16 (25%)
C2H2 Zn finger 207..225 CDD:275368 7/17 (41%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
C2H2 Zn finger 263..284 CDD:275368 8/20 (40%)
C2H2 Zn finger 292..311 CDD:275368 6/18 (33%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
ZNF479NP_001357058.1 KRAB 16..76 CDD:214630
COG5048 <170..372 CDD:227381 56/234 (24%)
C2H2 Zn finger 187..207 CDD:275368 6/26 (23%)
C2H2 Zn finger 215..235 CDD:275368 4/21 (19%)
C2H2 Zn finger 243..263 CDD:275368 5/21 (24%)
C2H2 Zn finger 271..291 CDD:275368 7/21 (33%)
C2H2 Zn finger 299..319 CDD:275368 6/19 (32%)
COG5048 <323..479 CDD:227381 38/136 (28%)
C2H2 Zn finger 327..347 CDD:275368 8/20 (40%)
C2H2 Zn finger 355..375 CDD:275368 6/19 (32%)
C2H2 Zn finger 383..403 CDD:275368 5/22 (23%)
C2H2 Zn finger 411..431 CDD:275368 6/25 (24%)
C2H2 Zn finger 439..459 CDD:275368 2/5 (40%)
C2H2 Zn finger 467..487 CDD:275368
zf-H2C2_2 480..503 CDD:338759
C2H2 Zn finger 495..515 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.