DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and ZNF628

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_149104.3 Gene:ZNF628 / 89887 HGNCID:28054 Length:1059 Species:Homo sapiens


Alignment Length:415 Identity:88/415 - (21%)
Similarity:124/415 - (29%) Gaps:144/415 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPQSSVPAPQPPGKRKKPAELELTCGWRDCQEICTGEWSLNGHIGDHLEHYAKAQDDRGAHAEHT 67
            :|.|.:|.|.||.....|....|.||                                       
Human   337 QPPSPLPQPPPPAAAPAPGFACLPCG--------------------------------------- 362

  Fly    68 EHQCTWNSCDFRTENQVEFERHSYYHGYYLNLLLQGKLECDLHPEIPACTAPARLMEKLPALGQN 132
                    ..|||  .....||.:.||                                .|.||.
Human   363 --------KSFRT--VAGLSRHQHSHG--------------------------------AAGGQA 385

  Fly   133 FRCGWTDCEREFVSIVEFQDHIVKHALFEYDIQKTPEDERPKTMCNWAMCHKHMGNKYRLIEHI- 196
            ||||  .|:..|..:.....|...|.......:..|:.|..:..|..              |.: 
Human   386 FRCG--SCDGSFPQLASLLAHQQCHVEEAAAGRPPPQAEAAEVTCPQ--------------EPLA 434

  Fly   197 -----------STHSNKKQVACFHCGELFRTKTTLFDHLRRQPENNTNSFQCAQCFKFFATKKLL 250
                       :..|.::...|..||:.|:..:.|..|||  .......:||.:|.|.|....||
Human   435 PAAPVPPPPPSAPASAERPYKCAECGKSFKGSSGLRYHLR--DHTGERPYQCGECGKAFKRSSLL 497

  Fly   251 KSHVVRH--VNCYKCTMCDMTCSSASSLTTHIRYRHLKDKPLKCSEC-----DTRCVRESDLAKH 308
            ..|...|  :..:.|..|.:|...:|....|:|. |..::|..|.||     :|.|:|     :|
Human   498 AIHQRVHTGLRAFTCGQCGLTFKWSSHYQYHLRL-HSGERPYACGECGKAFRNTSCLR-----RH 556

  Fly   309 VQIVHSKTVHQCEHPD----CHYSVRTYTQMRRHFLEVH-GNNPILYACHCCERFFKSGKSLSAH 368
                  :.||..|.|.    |..|....:.:|:| ..|| |..|  :.|..|.:.|....:|..|
Human   557 ------RHVHTGERPHACGVCGKSFAQTSNLRQH-QRVHTGERP--FRCPLCPKTFTHSSNLLLH 612

  Fly   369 LMKKHGFRLPSGHKRFTYRVDENGF 393
            .      |..|..:.||..:...||
Human   613 Q------RTHSAERPFTCPICGRGF 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 1/28 (4%)
C2H2 Zn finger 207..225 CDD:275368 6/17 (35%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 263..284 CDD:275368 6/20 (30%)
C2H2 Zn finger 292..311 CDD:275368 7/23 (30%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
ZNF628NP_149104.3 C2H2 Zn finger 38..58 CDD:275368
COG5048 <43..213 CDD:227381
C2H2 Zn finger 66..86 CDD:275368
C2H2 Zn finger 94..114 CDD:275368
C2H2 Zn finger 122..142 CDD:275368
C2H2 Zn finger 150..170 CDD:275368
C2H2 Zn finger 178..198 CDD:275368
zf-C2H2 204..226 CDD:306579
C2H2 Zn finger 206..226 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..247
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..280
C2H2 Zn finger 297..314 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..351 6/13 (46%)
C2H2 Zn finger 361..378 CDD:275370 7/65 (11%)
C2H2 Zn finger 388..408 CDD:275368 5/21 (24%)
COG5048 <453..642 CDD:227381 55/202 (27%)
C2H2 Zn finger 456..476 CDD:275368 8/21 (38%)
C2H2 Zn finger 484..504 CDD:275368 7/19 (37%)
C2H2 Zn finger 512..532 CDD:275368 6/20 (30%)
C2H2 Zn finger 540..560 CDD:275368 7/30 (23%)
C2H2 Zn finger 568..588 CDD:275368 4/20 (20%)
C2H2 Zn finger 596..616 CDD:275368 6/25 (24%)
C2H2 Zn finger 624..644 CDD:275368 2/8 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 644..674
4 X approximate tandem repeats. /evidence=ECO:0000250|UniProtKB:Q8CJ78 818..864
Interaction with TAF4B. /evidence=ECO:0000250|UniProtKB:Q8CJ78 943..1059
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.