DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and ZNF768

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_016879154.1 Gene:ZNF768 / 79724 HGNCID:26273 Length:564 Species:Homo sapiens


Alignment Length:255 Identity:71/255 - (27%)
Similarity:106/255 - (41%) Gaps:31/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 CEREFVSIVEFQDHIVKHALFEYDIQKTPEDERPKTMCNWAMCHKHMGNKYRLIEHISTHSNKKQ 204
            |.:.|..    ...::||       |:|...||| ..|  ..|.|...:...|:.|..|||.:|.
Human   318 CSKAFSQ----SSDLIKH-------QRTHTGERP-YKC--PRCGKAFADSSYLLRHQRTHSGQKP 368

  Fly   205 VACFHCGELFRTKTTLFDHLRRQPENNTNSFQCAQCFKFFATKKLLKSHVVRHV--NCYKCTMCD 267
            ..|.|||:.|...:.|..|.|  ..::...:.|.:|.|.::....|:||...|.  ..:.|.:|.
Human   369 YKCPHCGKAFGDSSYLLRHQR--THSHERPYSCTECGKCYSQNSSLRSHQRVHTGQRPFSCGICG 431

  Fly   268 MTCSSASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEHPDCHYSVRTY 332
            .:.|..|:|..|.| .|.::||.||.||..|..:.|.||.|.:.......:.|  |||..:....
Human   432 KSFSQRSALIPHAR-SHAREKPFKCPECGKRFGQSSVLAIHARTHLPGRTYSC--PDCGKTFNRS 493

  Fly   333 TQMRRHFLEVHGNNPILYACHCCERFFKSGKSLSAHLMKKHGFRLPSGHKRFTYRVDENG 392
            :.:.:|.....|..|  |.|..|.:.|....:|..|      .|:.||.:  .|:.|:.|
Human   494 STLIQHQRSHTGERP--YRCAVCGKGFCRSSTLLQH------HRVHSGER--PYKCDDCG 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 4/16 (25%)
C2H2 Zn finger 207..225 CDD:275368 7/17 (41%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
C2H2 Zn finger 263..284 CDD:275368 7/20 (35%)
C2H2 Zn finger 292..311 CDD:275368 8/18 (44%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
ZNF768XP_016879154.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.