DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and zgc:171673

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_005168174.1 Gene:zgc:171673 / 797138 ZFINID:ZDB-GENE-071004-20 Length:366 Species:Danio rerio


Alignment Length:372 Identity:82/372 - (22%)
Similarity:137/372 - (36%) Gaps:85/372 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PQSSVPAPQPPGKRKKPAELELTCGWRDCQEICTGEWSLNGHIGDHLEHYAKAQDDRGAHAEHTE 68
            |::| .:||    :.||:.|.:.|   .|.:..|.:.||.||:              ..|.....
Zfish    69 PRTS-KSPQ----KSKPSSLFICC---QCGKSFTRKQSLEGHM--------------NLHNGEKP 111

  Fly    69 HQCTWNSCDFRTENQVEFERHSYYHGYYLNLLLQGKLECDLHPEIPACTAPARLMEKLPALGQNF 133
            :.|......||.:..:.                       :|..:.....|             :
Zfish   112 YSCQQCGKSFRQKPNLR-----------------------VHMRVHTGEKP-------------Y 140

  Fly   134 RCGWTDCEREFVSIVEFQDHIVKHALFEYDIQKTPEDERPKTMCNWAMCHKHMGNKYRLIEHIST 198
            .|  ..|.:.|..:..::.|:..|.           .|:| .:|.  .|.|..........|...
Zfish   141 TC--KQCGKSFSLVQGYKIHMRSHT-----------GEKP-YVCQ--QCGKGFSQISSFNSHTRI 189

  Fly   199 HSNKKQVACFHCGELFRTKTTLFDHLRRQPENNTNSFQCAQCFKFFATKKLLKSHVVRH--VNCY 261
            |:.:|..:|..||:.|..|..|.||:  ...:...:|:|.||.|.|..|:.||.|:..|  ...:
Zfish   190 HTREKPYSCQLCGKDFSIKQHLNDHM--IIHSAEKAFECQQCGKTFFLKRHLKKHIRVHSGEKNF 252

  Fly   262 KCTMCDMTCSSASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEHPDCH 326
            .|.:|..:.:...||..|:|. |..:||..|.:|..|..:.:.|..||: .|::....|:  :|.
Zfish   253 TCQLCGNSFTQMYSLKRHMRI-HSGEKPYSCQQCGKRFTQNNSLDIHVR-THTERSFTCQ--ECG 313

  Fly   327 YSVRTYTQMRRHFLEVHGNNPILYACHCCERFFKSGKSLSAHLMKKH 373
            .|....:.:..| ::.||... .:.|..||:.|....:|:.| |:.|
Zfish   314 ESFNLKSDLNNH-VKTHGEEK-AFPCGQCEKSFSRKDNLNRH-MRAH 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 3/16 (19%)
C2H2 Zn finger 207..225 CDD:275368 8/17 (47%)
C2H2 Zn finger 237..257 CDD:275368 9/19 (47%)
C2H2 Zn finger 263..284 CDD:275368 6/20 (30%)
C2H2 Zn finger 292..311 CDD:275368 6/18 (33%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
zgc:171673XP_005168174.1 COG5048 67..>360 CDD:227381 82/372 (22%)
C2H2 Zn finger 86..106 CDD:275368 7/36 (19%)
zf-C2H2 112..134 CDD:278523 4/44 (9%)
C2H2 Zn finger 114..134 CDD:275368 4/42 (10%)
zf-H2C2_2 126..150 CDD:290200 4/61 (7%)
C2H2 Zn finger 142..162 CDD:275368 4/21 (19%)
zf-H2C2_2 156..179 CDD:290200 7/36 (19%)
C2H2 Zn finger 170..190 CDD:275368 4/21 (19%)
C2H2 Zn finger 198..218 CDD:275368 8/21 (38%)
C2H2 Zn finger 226..246 CDD:275368 9/19 (47%)
zf-H2C2_2 238..263 CDD:290200 6/24 (25%)
C2H2 Zn finger 254..274 CDD:275368 6/20 (30%)
zf-H2C2_2 266..291 CDD:290200 10/25 (40%)
C2H2 Zn finger 282..302 CDD:275368 6/20 (30%)
C2H2 Zn finger 309..329 CDD:275368 4/22 (18%)
zf-C2H2 335..357 CDD:278523 7/22 (32%)
C2H2 Zn finger 337..357 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.