DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and ZNF136

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_003428.1 Gene:ZNF136 / 7695 HGNCID:12920 Length:540 Species:Homo sapiens


Alignment Length:465 Identity:106/465 - (22%)
Similarity:160/465 - (34%) Gaps:119/465 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EICTGEWSLNGHIGDHLEHYAKAQDDRGAHAEHTEHQCTWNSCDFRTENQVEFERHSYYHGYYLN 98
            |:..|:.|||.||.||..|..|...:.|...: |.:|| |.  .|.:.:  .|..|...|     
Human   109 EVSMGQSSLNRHIKDHSGHEPKEYQEYGEKPD-TRNQC-WK--PFSSHH--SFRTHEIIH----- 162

  Fly    99 LLLQGKLECDLHPEIPACTAPARLMEKLPALGQNFRCGWTDCEREFVSIVEFQDHIVKHALFEYD 163
                                   ..|||      :.|  .:|.:.|.|:...:.||:.|:.:   
Human   163 -----------------------TGEKL------YDC--KECGKTFFSLKRIRRHIITHSGY--- 193

  Fly   164 IQKTPEDERPKTMCNWAMCHKHMGNKYRLIEHISTHSNKKQVACFHCGELFRTKTTLFDHLRR-- 226
               ||      ..|.  :|.|......|...|..:|:.:|...|..||:.|...|::..|:.:  
Human   194 ---TP------YKCK--VCGKAFDYPSRFRTHERSHTGEKPYECQECGKAFTCITSVRRHMIKHT 247

  Fly   227 -----------QPENNTNSFQ-------------CAQCFKFFATKKLLKSHVVRHV--NCYKCTM 265
                       :|.::.:|||             |.||.|.|:....|:.|...|.  ..|:|..
Human   248 GDGPYKCKVCGKPFHSLSSFQVHERIHTGEKPFKCKQCGKAFSCSPTLRIHERTHTGEKPYECKQ 312

  Fly   266 CDMTCSSASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEHP----DCH 326
            |....|...||..|.|. |..:||..|.:|. :..|.:...:    :|.:| |..|.|    :|.
Human   313 CGKAFSYLPSLRLHERI-HTGEKPFVCKQCG-KAFRSASTFQ----IHERT-HTGEKPYECKECG 370

  Fly   327 YSVRTYTQMRRHFLEVHGNNPILYACHCCERFFKSGKSLSAHLMKKHGFRLPSGHKRFTYRVDEN 391
            .:......||||.::..|..|  |.|..|.:.|.|......|      .|..:|.|.:..:....
Human   371 EAFSCIPSMRRHMIKHTGEGP--YKCKVCGKPFHSLSPFRIH------ERTHTGEKPYVCKHCGK 427

  Fly   392 GFYRLETTRLESLEVTQQILSPQVNDSLAKP----GTGSCYEIVDPTNTEFERIIVSNDPNEAQL 452
            .|....:.|:.....|.:           ||    ..|..:..::...|. |.|.....|.|.:.
Human   428 AFVSSTSIRIHERTHTGE-----------KPYECKQCGKAFSYLNSFRTH-EMIHTGEKPFECKR 480

  Fly   453 MGEVVISLPS 462
            .|:...|..|
Human   481 CGKAFRSSSS 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 4/16 (25%)
C2H2 Zn finger 207..225 CDD:275368 6/17 (35%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 263..284 CDD:275368 7/20 (35%)
C2H2 Zn finger 292..311 CDD:275368 3/18 (17%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
ZNF136NP_003428.1 KRAB 3..44 CDD:307490
C2H2 Zn finger 143..162 CDD:275368 6/23 (26%)
COG5048 157..526 CDD:227381 88/411 (21%)
C2H2 Zn finger 170..190 CDD:275368 6/21 (29%)
C2H2 Zn finger 198..218 CDD:275368 5/21 (24%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
C2H2 Zn finger 254..274 CDD:275368 4/19 (21%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..330 CDD:275368 7/20 (35%)
C2H2 Zn finger 338..358 CDD:275368 5/25 (20%)
C2H2 Zn finger 366..386 CDD:275368 5/19 (26%)
C2H2 Zn finger 394..414 CDD:275368 6/25 (24%)
C2H2 Zn finger 422..442 CDD:275368 2/19 (11%)
C2H2 Zn finger 450..470 CDD:275368 3/20 (15%)
C2H2 Zn finger 478..498 CDD:275368 3/13 (23%)
C2H2 Zn finger 506..526 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.