DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and znf995

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_017209820.1 Gene:znf995 / 563697 ZFINID:ZDB-GENE-080215-13 Length:358 Species:Danio rerio


Alignment Length:250 Identity:63/250 - (25%)
Similarity:94/250 - (37%) Gaps:47/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 QKTPEDERP---KTMCNWA--MCHKHMGNKYRLIEHISTHSNKKQVACFHCGELFRTKTTLFDHL 224
            :||....||   |..||::  .|.|....|.:|..||..|:.:|...|..||:.|.....|..|:
Zfish    60 KKTLSRGRPRKSKPRCNFSCKQCGKSFSQKPKLDVHIRDHTREKAYTCKQCGKSFYNTRNLTVHM 124

  Fly   225 RRQPENNTNSFQCAQCFKFFATKKLLKSHVVRHV--NCYKCTMCDMTCSSASSLTTHIRYRHLKD 287
            |  .......:.|.||.|.|.....|..|:..|.  ..|.|..|..:..:..:||.|:|. |..:
Zfish   125 R--IHTGERPYTCQQCGKSFHKTGNLTVHLRIHTGERPYTCQQCGKSFQTTGNLTVHMRI-HTGE 186

  Fly   288 KPLKCSECDTRCVRESDLAKHVQIVHSKTVHQC----------EHPDCHYSVRT----------- 331
            ||..|.:|.....:.|:|..|::..:......|          ::.|.|..:.|           
Zfish   187 KPYSCPQCGKSYSQNSNLEVHMRTHNGGRTFVCTQCGKSFVKKQNLDLHMRIHTGEKPYTCTECG 251

  Fly   332 ----YTQMRRHFLEVH-GNNPILYACHCCERFFKSGKSLSAHLMKKHGFRLPSGH 381
                |....:|.:.|| |..|  :||..|.:.|....:|..|:         :||
Zfish   252 KSFPYKSTLKHHMIVHTGEKP--FACAQCGKSFTCNANLRNHM---------NGH 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 6/16 (38%)
C2H2 Zn finger 207..225 CDD:275368 6/17 (35%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 263..284 CDD:275368 6/20 (30%)
C2H2 Zn finger 292..311 CDD:275368 5/18 (28%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
znf995XP_017209820.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.