DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and ZNF416

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_060349.1 Gene:ZNF416 / 55659 HGNCID:20645 Length:594 Species:Homo sapiens


Alignment Length:394 Identity:90/394 - (22%)
Similarity:131/394 - (33%) Gaps:110/394 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PGKRKKPAELELTCGWRDCQEICTGEWSLNGHIGDHLEHYAKAQDDRGAHAEHTEHQCTWNSCDF 78
            ||:|  |.|         |.| |...:|...|:.||          |..|.....:.|  ..|..
Human   265 PGER--PYE---------CSE-CGKSFSQTSHLNDH----------RRIHTGERPYVC--GQCGK 305

  Fly    79 RTENQVEFERHSYYHGYYLNLLLQGKLECDLHPEIPACTAPARLMEKLPALGQN-FRCGWTDCER 142
            ....:....:|...|                                   .|:. :.||  :|.:
Human   306 SFSQRATLIKHHRVH-----------------------------------TGERPYECG--ECGK 333

  Fly   143 EFVSIVEFQDHIVKHALFEYDIQKTPEDERPKTMCNWAMCHKHMGNKYRLIEHISTHSNKKQVAC 207
            .|.......:|...|.           .|||.. |:  .|.|..|:|..|:.|..||:.:|...|
Human   334 SFSQSSNLIEHCRIHT-----------GERPYE-CD--ECGKAFGSKSTLVRHQRTHTGEKPYEC 384

  Fly   208 FHCGELFRTKTTLFDHLRRQPENNTNSFQCAQCFKFFATKKLLKSHVVRHVNC--YKCTMCDMTC 270
            ..||:|||...:|..|.|  .......::|.||.|.|:.|..|..|.:.|...  ::|..|..:.
Human   385 GECGKLFRQSFSLVVHQR--IHTTARPYECGQCGKSFSLKCGLIQHQLIHSGARPFECDECGKSF 447

  Fly   271 SSASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQC--------------E 321
            |..::|..|.:. |..::|..|.||....:.:|.|.:|.:....:...:|              |
Human   448 SQRTTLNKHHKV-HTAERPYVCGECGKAFMFKSKLVRHQRTHTGERPFECSECGKFFRQSYTLVE 511

  Fly   322 HPDCHYSVRTYT--QMRRHFLE---------VH-GNNPILYACHCCERFFKSGKSLSAHLMKKHG 374
            |...|..:|.|.  |..:.|::         || |..|  |.|..|.:.|.....|..| .|.|.
Human   512 HQKIHTGLRPYDCGQCGKSFIQKSSLIQHQVVHTGERP--YECGKCGKSFTQHSGLILH-RKSHT 573

  Fly   375 FRLP 378
            ...|
Human   574 VERP 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 6/16 (38%)
C2H2 Zn finger 207..225 CDD:275368 8/17 (47%)
C2H2 Zn finger 237..257 CDD:275368 8/19 (42%)
C2H2 Zn finger 263..284 CDD:275368 5/20 (25%)
C2H2 Zn finger 292..311 CDD:275368 6/18 (33%)
C2H2 Zn finger 352..373 CDD:275368 6/20 (30%)
ZNF416NP_060349.1 KRAB 28..67 CDD:307490
COG5048 77..506 CDD:227381 70/318 (22%)
C2H2 Zn finger 247..264 CDD:275368
C2H2 Zn finger 272..292 CDD:275368 8/30 (27%)
C2H2 Zn finger 300..320 CDD:275368 3/21 (14%)
C2H2 Zn finger 328..348 CDD:275368 5/21 (24%)
C2H2 Zn finger 356..376 CDD:275368 7/21 (33%)
C2H2 Zn finger 384..404 CDD:275368 9/21 (43%)
C2H2 Zn finger 412..432 CDD:275368 8/19 (42%)
C2H2 Zn finger 440..460 CDD:275368 5/20 (25%)
C2H2 Zn finger 468..488 CDD:275368 6/19 (32%)
SFP1 <490..573 CDD:227516 19/85 (22%)
C2H2 Zn finger 496..516 CDD:275368 3/19 (16%)
C2H2 Zn finger 524..544 CDD:275368 2/19 (11%)
C2H2 Zn finger 552..572 CDD:275368 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 569..594 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.