DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and wek

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001260472.1 Gene:wek / 48785 FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster


Alignment Length:247 Identity:55/247 - (22%)
Similarity:83/247 - (33%) Gaps:63/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 PKTMCNWAMC-------HKHMGNKYRLIEHISTHSNKKQVACFHCGELFRTKTTLFDHLRRQPEN 230
            |..:||....       |||           ..|...|:..|.|||:..:|.|:|.:|.....|.
  Fly   272 PCKICNETFMSFMALRRHKH-----------DMHGGPKKYVCDHCGKGLKTFTSLVEHQLVHTEE 325

  Fly   231 NTNSFQCAQCFKFFATKKLLKSHVVRHVN-CYKCTMCDMTCSSASSLTTHIRYRHLKDKPLKCSE 294
              ....|..|...|..|..|:.|...|.. .::|.:|.....:.:.|..| :|.|..::..||..
  Fly   326 --KPCICPVCNAGFKNKARLRVHSQTHGEPKFECNVCGKKLQTRAILNKH-KYVHTDERRFKCEV 387

  Fly   295 CDTRCVRESDLAKHVQIVHSKTVHQCEHPDCHYSVRTYTQMRRHFLEVHGNNPILYACHCCERFF 359
            |.:.|                              :..|.::.|.|...|..|  |.|..|.:.|
  Fly   388 CGSGC------------------------------KNSTALKIHLLGHTGLRP--YVCKYCGKAF 420

  Fly   360 KSGKSLSAHLMKKHGFRLPSGHKRFTYRVDENGFYRLETTRLESLE-VTQQI 410
            .|..:..:|..||        |.....:.||....|:....||.|. :|:::
  Fly   421 ASNTNCRSHKWKK--------HPELASKEDETESSRVPVPTLEELRAITREM 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 3/23 (13%)
C2H2 Zn finger 207..225 CDD:275368 8/17 (47%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
C2H2 Zn finger 263..284 CDD:275368 5/20 (25%)
C2H2 Zn finger 292..311 CDD:275368 3/18 (17%)
C2H2 Zn finger 352..373 CDD:275368 6/20 (30%)
wekNP_001260472.1 zf-AD 11..80 CDD:214871
C2H2 Zn finger 273..294 CDD:275368 5/31 (16%)
C2H2 Zn finger 302..322 CDD:275368 8/19 (42%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
C2H2 Zn finger 357..377 CDD:275368 5/20 (25%)
C2H2 Zn finger 385..405 CDD:275368 6/49 (12%)
zf-H2C2_2 397..422 CDD:290200 8/26 (31%)
C2H2 Zn finger 413..429 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.