DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and AgaP_AGAP008795

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_001237617.1 Gene:AgaP_AGAP008795 / 4577995 VectorBaseID:AGAP008795 Length:331 Species:Anopheles gambiae


Alignment Length:33 Identity:11/33 - (33%)
Similarity:16/33 - (48%) Gaps:1/33 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 CTMCDMTCSSASSLTTHIRYRHLKDKPLKCSEC 295
            |.:||....|.:....|.| .|:...|.:|:||
Mosquito   270 CYICDTHHESIAQRDDHFR-NHIHMLPYECTEC 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368
C2H2 Zn finger 207..225 CDD:275368
C2H2 Zn finger 237..257 CDD:275368
C2H2 Zn finger 263..284 CDD:275368 6/20 (30%)
C2H2 Zn finger 292..311 CDD:275368 3/4 (75%)
C2H2 Zn finger 352..373 CDD:275368
AgaP_AGAP008795XP_001237617.1 zf-AD 21..94 CDD:214871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.