DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and AgaP_AGAP007518

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_001237071.2 Gene:AgaP_AGAP007518 / 4576462 VectorBaseID:AGAP007518 Length:391 Species:Anopheles gambiae


Alignment Length:408 Identity:83/408 - (20%)
Similarity:138/408 - (33%) Gaps:125/408 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PAPQPPGKRKKPAELELTCGWRD--CQEICTGE-----WSLNGHIGDHLEHYAKAQDDRGAHAEH 66
            |.|:...::|:..:.|:...::.  | |||..|     .::.|..||.....|.|.....|.|..
Mosquito    54 PGPELTEEQKQTLDREIFDFYKPIIC-EICDPEKVAVAVAVAGPGGDPGSVAAGAGHPEAAAAAT 117

  Fly    67 TEHQCTWNSCDFRTENQVEFERHSYYHGYYLNLLLQGKLECDLHPEIPACTAPARLMEKL----- 126
            |:.:      ::|:..|:. :.....||     |..|.::|.|      |....|...||     
Mosquito   118 TQEE------EYRSLKQLN-QHMRTVHG-----LESGTVKCQL------CAKKFRSRVKLVEHKD 164

  Fly   127 ----PALGQNFRCGWTDCEREFVSIVEFQDHIVKHALFEYDIQKTPEDERPKTMCNWAMCHKHMG 187
                |   :.||||  .|:....::.|...:  ||..:|:..::               |.|...
Mosquito   165 MHENP---ERFRCG--VCQEVHQNLEEHMQN--KHQEWEFACEE---------------CGKRFP 207

  Fly   188 NKYRLIEHISTHSNKKQVACFHCGELFRTKTTLFDHLRRQPENNTNSFQCAQCFKFFATKKLLKS 252
            .|.||..|::....||.:.|..|.:.| ||.::..| ::....:..:|.|..|.|.|.|:..|:.
Mosquito   208 FKNRLTAHMAKVHMKKDIICEECNKPF-TKFSIEKH-KKTVHGHGGTFICENCPKTFKTRVSLER 270

  Fly   253 HVVRHVN----------------------------CYKCTMCDMTCSSASSLTTHIRYRHLKDKP 289
            |:..|.|                            ...|::|:.......:|..|::..|.:..|
Mosquito   271 HMEGHNNGEQQQPPQQQQPQPLPLPLPQQQPSSAATVSCSLCNSVLKDEYNLKAHMKRIHAEQTP 335

  Fly   290 LKCSECDTRCVRESDLAKHVQIVHSKTVHQCEHPDCHYSVRTYTQMRRHFLEVHGNNPI---LYA 351
            ..|:.|.                                 :|:..  :|.|..|..|..   |:.
Mosquito   336 ATCNTCG---------------------------------KTFKS--KHSLNTHTANVCTTRLFG 365

  Fly   352 CHCCERFFKSGKSLSAHL 369
            |..|.:.||....|..|:
Mosquito   366 CTTCGKQFKKRTKLKQHM 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 6/16 (38%)
C2H2 Zn finger 207..225 CDD:275368 6/17 (35%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 263..284 CDD:275368 4/20 (20%)
C2H2 Zn finger 292..311 CDD:275368 2/18 (11%)
C2H2 Zn finger 352..373 CDD:275368 6/18 (33%)
AgaP_AGAP007518XP_001237071.2 C2H2 Zn finger 174..191 CDD:275368 4/20 (20%)
C2H2 Zn finger 199..220 CDD:275368 6/35 (17%)
C2H2 Zn finger 227..245 CDD:275368 6/19 (32%)
C2H2 Zn finger 309..330 CDD:275368 4/20 (20%)
C2H2 Zn finger 338..354 CDD:275368 5/50 (10%)
C2H2 Zn finger 366..386 CDD:275368 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X96
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.