DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and zfh1

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_733401.3 Gene:zfh1 / 43650 FlyBaseID:FBgn0004606 Length:1206 Species:Drosophila melanogaster


Alignment Length:186 Identity:45/186 - (24%)
Similarity:65/186 - (34%) Gaps:45/186 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 CFHCGELFRTKTTLFDHLRRQ----PENNTNSFQ-CAQCFKFFATKKLLKSHVVRH-----VNCY 261
            |..|...|.::..|..|.:..    |...:|..| |..|.|.||....|:.|::.|     :..:
  Fly   291 CMQCTASFASREQLEQHEQLHSPCGPAAVSNVSQTCRICHKAFANVYRLQRHMISHDESALLRKF 355

  Fly   262 KCTMCDMTCSSASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEHPDCH 326
            ||..||........|..|:|. |..:||..|..|..|.......:.|:      |..:|....  
  Fly   356 KCKECDKAFKFKHHLKEHVRI-HSGEKPFGCDNCGKRFSHSGSFSSHM------TSKKCISMG-- 411

  Fly   327 YSVRTYTQMRRHFLEVHGNNPILYACHCCERFFKS-GKSLSAHLMKKHGFRLPSGH 381
                         |:::.|..:|      :|..|| |.:.||      ..|.||.|
  Fly   412 -------------LKLNNNRALL------KRLEKSPGSASSA------SRRSPSDH 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368
C2H2 Zn finger 207..225 CDD:275368 5/17 (29%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 263..284 CDD:275368 6/20 (30%)
C2H2 Zn finger 292..311 CDD:275368 4/18 (22%)
C2H2 Zn finger 352..373 CDD:275368 6/21 (29%)
zfh1NP_733401.3 C2H2 Zn finger 291..311 CDD:275368 5/19 (26%)
C2H2 Zn finger 326..346 CDD:275368 7/19 (37%)
zf-C2H2 355..377 CDD:278523 7/22 (32%)
C2H2 Zn finger 357..377 CDD:275368 6/20 (30%)
zf-H2C2_2 369..391 CDD:290200 8/22 (36%)
Homeobox 703..755 CDD:278475
C2H2 Zn finger 969..989 CDD:275368
zf-H2C2_2 981..1006 CDD:290200
COG5048 992..>1045 CDD:227381
C2H2 Zn finger 997..1017 CDD:275368
zf-H2C2_2 1009..1034 CDD:290200
C2H2 Zn finger 1025..1042 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24391
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.