DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and CG6254

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster


Alignment Length:317 Identity:77/317 - (24%)
Similarity:123/317 - (38%) Gaps:59/317 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 DCEREFVSIVEFQDHIVK-HALFEYDIQKTPEDERPKTMCNWAMCHKHMGNKYRLIEHISTHSNK 202
            |..||.|:  :.:|.|.: .|:::.:|.|.|. ::||..      .:||..     .|.:...:.
  Fly   309 DISREHVT--DEEDEISEVPAMYKCNICKKPY-KKPKAY------KRHMEE-----VHNTVADDL 359

  Fly   203 KQVACFHCGELFRTKTTLF----DHLRRQPENNTNSFQCAQCFKFFATKKLLKSHVV---RHVNC 260
            .|:.|..|...|.|...|.    .|:|.:|:.:.   .|..|.|.|.|...||.|:.   ..:..
  Fly   360 PQLECNQCKLCFPTVAQLHAHHRTHVRAKPKTDN---CCPHCEKRFTTSGTLKRHIEGIHNQIKP 421

  Fly   261 YKCTMCDMTCSSASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEHPDC 325
            |.|.:|..:.:..:.|..| :..|..:.|.:|..|.......:.|..|:. .||..:::|  ..|
  Fly   422 YVCDLCGKSFNYITGLKDH-KLVHTDECPFECPVCKRGFKNNARLKIHLD-THSAEIYEC--TVC 482

  Fly   326 HYSVRTYTQMRRHFLEVHGNNPILYACHCCERFFKSGKSLSAHLMKKHGFR----------LPSG 380
            ...::|.....:|.| ||.:.. .:.|..|...||..|:|.|||:...|.|          ..:|
  Fly   483 GLKLKTRRTFNKHKL-VHSDTR-QFKCEVCGSAFKRSKTLKAHLILHTGIRPYKCNFCGRDFANG 545

  Fly   381 -----HKRFTYRVDENGFYRLETTRLESLEVTQQILSPQVND-----SLAKPGTGSC 427
                 |||..        :..|....|:..||:..|.|.:::     .|.|...|.|
  Fly   546 SNCRSHKRQA--------HPKELAEEEARGVTRSTLLPMLDELTIASKLLKTPAGPC 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 3/16 (19%)
C2H2 Zn finger 207..225 CDD:275368 6/21 (29%)
C2H2 Zn finger 237..257 CDD:275368 8/22 (36%)
C2H2 Zn finger 263..284 CDD:275368 4/20 (20%)
C2H2 Zn finger 292..311 CDD:275368 4/18 (22%)
C2H2 Zn finger 352..373 CDD:275368 9/20 (45%)
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 51/209 (24%)
C2H2 Zn finger 364..384 CDD:275368 5/19 (26%)
C2H2 Zn finger 395..416 CDD:275368 8/20 (40%)
C2H2 Zn finger 424..444 CDD:275368 4/20 (20%)
C2H2 Zn finger 452..472 CDD:275368 4/20 (20%)
C2H2 Zn finger 479..499 CDD:275368 5/22 (23%)
C2H2 Zn finger 507..527 CDD:275368 9/19 (47%)
zf-H2C2_2 520..544 CDD:290200 6/23 (26%)
C2H2 Zn finger 535..553 CDD:275368 2/17 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.