DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and CG4707

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_611944.1 Gene:CG4707 / 37935 FlyBaseID:FBgn0035036 Length:673 Species:Drosophila melanogaster


Alignment Length:466 Identity:97/466 - (20%)
Similarity:166/466 - (35%) Gaps:126/466 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPQSSVPAPQPPGKRKKPAELELTCGWRDCQEICTGEWSLNGHIGDHLEHYAK----AQDDRGAH 63
            ||..:.|...|..|::..:|        |.:|        |....:.:|..|.    ..||    
  Fly   209 RPPKAKPESAPSPKKELDSE--------DGEE--------NARDNNDMEFVAPEAVLGTDD---- 253

  Fly    64 AEHTEHQCTWNSCDFRTENQVEFERHSYYHGYYLNLLLQGKLECDLHPEIPACTAPARLMEK--- 125
                       |....:|:..|...||.               .|:.||......|.|::.|   
  Fly   254 -----------SSSSSSESSGEDSDHSL---------------PDIEPEERYAEIPKRVVVKPKK 292

  Fly   126 --------LPALGQNFRCGWTDCEREFVSIVEFQDHIVKHALFEYDIQKTPEDERPKTMC----- 177
                    :|.:    |....:.||..:...|:.:.|::  .|:         :.|.::|     
  Fly   293 YRKREKPLVPPV----RLSREEIERRKLQQDEYDEIILQ--FFK---------KFPCSLCNLLVQ 342

  Fly   178 NWAMCHKHM--------------GNKYR----LIEHISTHSNKKQVACFHCGELFRTKTTLFDH- 223
            |:|...:|.              |.|:.    |.||:..|.|.....|..||.:|:....|..| 
  Fly   343 NFADMRRHQRVSHNIESGYIECCGRKFHLRKALAEHVLVHKNPDHFMCSQCGRVFQDSRALEVHE 407

  Fly   224 -------LRRQPENNTNSFQCAQCFKFFATKKLLKSH-VVRHVN----CYKCTMCDMTCSSASSL 276
                   ::.:|:.. ..:||.:|.|.|.||..::.| |.:||.    .|.|..|:....:...|
  Fly   408 QTHTNPEVKAEPKEK-RIYQCEKCPKSFTTKAAMEYHDVSKHVPKSEFKYSCPECNKKIPTERKL 471

  Fly   277 TTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVH------QCEHPDCHYSVRTYTQM 335
            ..|:||.|..:..:.|.:|......:::|.||.::.||:...      |||  .|...:|..:.:
  Fly   472 KEHLRYMHDPEAAIICDKCGKTLRSQTNLKKHHELEHSEKPRPKPDPVQCE--ICGTWLRHLSGL 534

  Fly   336 RRHFLEVHGNNPILYACHCCERFFKSGKSLSAHLMKKHGFRLPSGHKRFTYRVDENGFYRLETTR 400
            ::|...||......:.||.|.:...:.::|..|:...|     ...::|...:.|..|.|.:..|
  Fly   535 KQHMKTVHEPPGDEHRCHICNKTSTNSRALKRHIYHNH-----LCERKFKCGMCEKAFKRPQDLR 594

  Fly   401 LESLEVTQQIL 411
            ..:...|.::|
  Fly   595 EHTSTHTGEVL 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 6/34 (18%)
C2H2 Zn finger 207..225 CDD:275368 6/25 (24%)
C2H2 Zn finger 237..257 CDD:275368 8/20 (40%)
C2H2 Zn finger 263..284 CDD:275368 6/20 (30%)
C2H2 Zn finger 292..311 CDD:275368 5/18 (28%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
CG4707NP_611944.1 zf-AD 3..73 CDD:285071
C2H2 Zn finger 334..355 CDD:275368 4/20 (20%)
LIM <361..407 CDD:295319 12/45 (27%)
C2H2 Zn finger 365..382 CDD:275368 5/16 (31%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
C2H2 Zn finger 427..443 CDD:275368 6/15 (40%)
C2H2 Zn finger 458..476 CDD:275368 4/17 (24%)
C2H2 Zn finger 487..507 CDD:275368 5/19 (26%)
C2H2 Zn finger 521..540 CDD:275368 5/20 (25%)
C2H2 Zn finger 551..572 CDD:275368 5/20 (25%)
C2H2 Zn finger 580..600 CDD:275368 4/19 (21%)
C2H2 Zn finger 608..629 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.