DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and kmg

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_609604.1 Gene:kmg / 34706 FlyBaseID:FBgn0032473 Length:747 Species:Drosophila melanogaster


Alignment Length:348 Identity:67/348 - (19%)
Similarity:120/348 - (34%) Gaps:106/348 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRPQSSVPAPQPPGKRKKPAELELTCGWR--DCQEICTGEWSLNGHIGDHLEHYAKAQDDRGAHA 64
            |..|:|....:...|...|...||..|..  .||: |:....:......|:::            
  Fly   291 LEQQNSSSDSEETAKSPSPDTRELVSGKEQFQCQK-CSYSTPIRARFKKHVKY------------ 342

  Fly    65 EHTEHQCTWNSCDFRTENQVEFERHSYYHGYYLNLLLQGKLECDLHPEIPACTAPARLMEKLPAL 129
             |:......:||||.|..:...:||:..||      ..|..:|       :|             
  Fly   343 -HSMPLIKCSSCDFHTPYKWNLDRHTKNHG------ANGHFKC-------SC------------- 380

  Fly   130 GQNFRCGWTDCEREFVSIVEFQDHIVK--HALFE------YDI--QKTPEDERPKTMCN------ 178
                 |.::...::.::|.|...|:..  |.:..      .|:  |::....:|:|..|      
  Fly   381 -----CDFSTDIKQSLTIHESNHHVPMPVHQMGNRSRDEAEDLVDQQSSGSRKPETFKNGGATVA 440

  Fly   179 -------------WAMCHKHMGNKYRLIEH-----ISTHSNKKQVACF----------------- 208
                         .:.|.|.:||..:||.|     ::.|:..:..|..                 
  Fly   441 STESLLPRTSGIVCSHCQKRVGNAMQLINHLQVCTLALHNTTQLQASINAEVDLHDEDFPNAPTD 505

  Fly   209 --HCG-ELFRTKTTLFDHLRRQPENNT---NSFQCAQCFKFFATKKLLKSHVVRHVN--CYKCTM 265
              :|| |.......:.:.|..:||:..   ..|:|..|..:.||......|:|.|:|  .::|::
  Fly   506 LSYCGVETAPGYGEVTEVLPEEPEDLAPLKKVFKCPHCSFWAATASRFHVHIVGHLNRKPFECSL 570

  Fly   266 CDMTCSSASSLTTHIRYRHLKDK 288
            |....:....:|.|||.:.|:|:
  Fly   571 CAYRSNWRWDITKHIRLKALRDR 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 7/21 (33%)
C2H2 Zn finger 207..225 CDD:275368 3/37 (8%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
C2H2 Zn finger 263..284 CDD:275368 6/20 (30%)
C2H2 Zn finger 292..311 CDD:275368
C2H2 Zn finger 352..373 CDD:275368
kmgNP_609604.1 C2H2 Zn finger 540..560 CDD:275370 6/19 (32%)
C2H2 Zn finger 568..586 CDD:275370 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.