DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and CG9932

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_609599.1 Gene:CG9932 / 34701 FlyBaseID:FBgn0262160 Length:2171 Species:Drosophila melanogaster


Alignment Length:486 Identity:105/486 - (21%)
Similarity:158/486 - (32%) Gaps:155/486 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KRKKPAELE-LTCGWRDCQEI--CTGEWSLNGHIGDHLEHYAKAQDDRGAHAEHTEHQCTWNSCD 77
            |.|..|:.| |.|   .|..:  |..|..::|. ..|.......:|:.|.|.:         ..|
  Fly   601 KLKTGAQHENLVC---QCGHVAKCLSESIIHGK-SCHASAVIIDEDEAGLHED---------DGD 652

  Fly    78 FRTENQVEFERHSYYHGYYLNLLLQGKLECD--LHPEIPACTAPARLMEKLPALGQNFRCGWTDC 140
            .|.|...:.|.|..:..  |||.:.|...|.  .|    .|.:...||..|....:..||     
  Fly   653 DRLEIDEDDEDHHSHSA--LNLSVTGSTRCQHCRH----RCKSSTDLMHHLKQCVEAIRC----- 706

  Fly   141 EREFVSIVEFQDHIVKHALFEYDIQKTPE-DERP-------------KTMCNWAMCHKHMGNKYR 191
                             |...||...... |.||             :.:|.|            
  Fly   707 -----------------ANEMYDSNSGESGDRRPDSQSLQQQAAVQQQRVCIW------------ 742

  Fly   192 LIEHISTHSNK--KQVACFHCGELFRTKTTLFDHLRRQP------ENNTNSFQCAQCFKFF--AT 246
                     ||  |::.......|.:.|..  .:|.:.|      .|..||:...:....:  .|
  Fly   743 ---------NKATKEIIAAAAASLQQDKNN--HNLVKSPTGSQAASNEENSYYGVETAPGYGEVT 796

  Fly   247 KKLLKSHVVRHVN---CYKCTMCDMTCSSASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAKH 308
            ||:.......:.:   .|||..|....|:||....|| ..||..||.:||.|..|.....|:.||
  Fly   797 KKMTPEEEAANSSLKKVYKCPHCSFWASTASRFHVHI-VGHLNKKPFECSLCSYRSNWRWDITKH 860

  Fly   309 VQIVHSKTVHQCEHPDCHYSVRTYTQMRRHFLEVHGNNPILYACHCCERFFKSGKSLSAHLMKKH 373
            :::   ||:....|......:...|..|                    .:.|..|.::  |||. 
  Fly   861 IRL---KTIRDPSHKTAKVLMNDETGRR--------------------NYTKYNKYIT--LMKV- 899

  Fly   374 GFRLPSGHKRFTYRVDENGFYRLETTRLESLEVT-QQILSPQVNDSLAKPGTGSCYEI-VDPTNT 436
                          .:|:|..:|    ::|.|:| .|:.|.......||.|:.|..:| ::|   
  Fly   900 --------------TEEDGDPKL----MKSGEMTPNQVASLAFLKDYAKVGSVSGQDITLEP--- 943

  Fly   437 EFERIIVSNDPN---EAQLMGEVVISLPSLA 464
                 ::.|.||   :|.| .:.:|.:|.||
  Fly   944 -----VLPNKPNVLDDAHL-ADNLIRIPLLA 968

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 0/16 (0%)
C2H2 Zn finger 207..225 CDD:275368 2/17 (12%)
C2H2 Zn finger 237..257 CDD:275368 3/21 (14%)
C2H2 Zn finger 263..284 CDD:275368 7/20 (35%)
C2H2 Zn finger 292..311 CDD:275368 7/18 (39%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
CG9932NP_609599.1 C2H2 Zn finger 339..359 CDD:275368
C2H2 Zn finger 366..386 CDD:275368
C2H2 Zn finger 394..414 CDD:275368
C2H2 Zn finger 816..836 CDD:275370 7/20 (35%)
C2H2 Zn finger 844..862 CDD:275370 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444654
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.