DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and ZSCAN22

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001308045.1 Gene:ZSCAN22 / 342945 HGNCID:4929 Length:491 Species:Homo sapiens


Alignment Length:460 Identity:100/460 - (21%)
Similarity:164/460 - (35%) Gaps:140/460 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DHLEHYAKAQDDRGAHAEHTE----HQ---------CTWNSCDFRTENQVEFERHSYYHGYYLNL 99
            ||:.| ::|...|..|..:.|    |:         |.|...:..::.|:            |.|
Human    40 DHIAH-SEAARLRFRHFRYEEASGPHEALAHLRALCCQWLQPEAHSKEQI------------LEL 91

  Fly   100 LLQGKLECDLHPEIPA---------------------------------------C-------TA 118
            |:..:....|.|||.|                                       |       :.
Human    92 LVLEQFLGALPPEIQAWVGAQSPKSGEEAAVLVEDLTQVLDKRGWDPGAEPTEASCKQSDLGESE 156

  Fly   119 PARLMEKL-------PAL-------GQNFRCG-----WTDCEREFVSIVEFQDHIVKHALFEYDI 164
            |:.:.|.|       ||.       |.:.|.|     ||.      |:.: |.|..|.:....|:
Human   157 PSNVTETLMGGVSLGPAFVKACEPEGSSERSGLSGEIWTK------SVTQ-QIHFKKTSGPYKDV 214

  Fly   165 QKTPEDERPK-------TMCNWAMCHKH----MGNKYRLIEHIS-----THSNKKQVACFHCGEL 213
               |.|:|.:       :...|......    ..:|:.|::...     |:|.|:...|..|.::
Human   215 ---PTDQRGRESGASRNSSSAWPNLTSQEKPPSEDKFDLVDAYGTEPPYTYSGKRSSKCRECRKM 276

  Fly   214 FRTKTTLFDHLRRQPENNTNSFQCAQCFKFFATKKLLKSHVVRHVNC--YKCTMCDMTCSSASSL 276
            |::.:.|..|  ::..:....:.|::|.|.|:....|..|.|.|...  ::|..|....|..:.|
Human   277 FQSASALEAH--QKTHSRKTPYACSECGKAFSRSTHLAQHQVVHTGAKPHECKECGKAFSRVTHL 339

  Fly   277 TTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEHPDCHYSVRTY-TQMRRHFL 340
            |.|.|. |..:||.||.||.....|.:.|.:|.::...:..::|:.....:|..|: ||.:|   
Human   340 TQHQRI-HTGEKPYKCGECGKTFSRSTHLTQHQRVHTGERPYECDACGKAFSQSTHLTQHQR--- 400

  Fly   341 EVH-GNNPILYACHCCERFFKSGKSLSAHLMKKHGFRLPSGHKRFTYRVDENGFYR----LETTR 400
             :| |..|  |.|..|.|.|....:|..||      |:.||.|.:..:|....|.:    :|..|
Human   401 -IHTGEKP--YKCDACGRAFSDCSALIRHL------RIHSGEKPYQCKVCPKAFAQSSSLIEHQR 456

  Fly   401 LESLE 405
            :.:.|
Human   457 IHTGE 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 2/25 (8%)
C2H2 Zn finger 207..225 CDD:275368 5/17 (29%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 263..284 CDD:275368 7/20 (35%)
C2H2 Zn finger 292..311 CDD:275368 6/18 (33%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
ZSCAN22NP_001308045.1 SCAN 45..133 CDD:307924 16/99 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..161 2/26 (8%)
COG5048 <174..482 CDD:227381 75/313 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..249 7/47 (15%)
C2H2 Zn finger 270..290 CDD:275368 5/21 (24%)
C2H2 Zn finger 298..318 CDD:275368 7/19 (37%)
C2H2 Zn finger 326..346 CDD:275368 7/20 (35%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
C2H2 Zn finger 382..402 CDD:275368 6/23 (26%)
C2H2 Zn finger 410..430 CDD:275368 8/25 (32%)
C2H2 Zn finger 438..458 CDD:275368 4/19 (21%)
C2H2 Zn finger 466..486 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.