DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and AgaP_AGAP011405

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_554837.3 Gene:AgaP_AGAP011405 / 3291310 VectorBaseID:AGAP011405 Length:438 Species:Anopheles gambiae


Alignment Length:216 Identity:54/216 - (25%)
Similarity:85/216 - (39%) Gaps:28/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PEDERPKTMCNWAMC-------HKHMGNKYRLIEHISTHSNKKQVACFHCGELFRTKTTLFDHLR 225
            |:.::.|.:|:  .|       .:|..|..:||:|          ||.||.......:.|..|:.
Mosquito   225 PKKKQRKYLCD--TCGVLINDLPRHTLNHSKLIKH----------ACPHCPVEMVEYSNLLRHIE 277

  Fly   226 RQPENNTNSFQCAQCFKFFATKKLLKSHVVRH---VNCYKCTMCDMTCSSASSLTTHIRYRHLKD 287
            ...|..... .|..|.|.|.....|.||:|.|   .:.:||.:|......||.|..|::..|...
Mosquito   278 AVHEKRIRK-SCELCGKGFTHNNSLVSHMVVHHGIGDTHKCKVCPKVFRHASGLRGHVKKCHSNA 341

  Fly   288 KPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEHPDCHYSVRTYTQMRRHFLEVHGNNPILYAC 352
            ...:||.|........||.||.:...|:..::|.  :|  ..|..:|..|...| ..::.:||.|
Mosquito   342 TKFECSLCGAFFSSRYDLKKHGRSHSSERPYECS--EC--GKRFKSQYARRIHE-QAHSGLLYEC 401

  Fly   353 HCCERFFKSGKSLSAHLMKKH 373
            ..|.|.::....:..|:.:.|
Mosquito   402 DVCRRPYRYKALMRMHMKRTH 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 6/23 (26%)
C2H2 Zn finger 207..225 CDD:275368 5/17 (29%)
C2H2 Zn finger 237..257 CDD:275368 8/19 (42%)
C2H2 Zn finger 263..284 CDD:275368 6/20 (30%)
C2H2 Zn finger 292..311 CDD:275368 7/18 (39%)
C2H2 Zn finger 352..373 CDD:275368 4/20 (20%)
AgaP_AGAP011405XP_554837.3 zf-AD 12..86 CDD:285071
C2H2 Zn finger 259..280 CDD:275370 5/20 (25%)
C2H2 Zn finger 288..308 CDD:275370 8/19 (42%)
C2H2 Zn finger 317..338 CDD:275368 6/20 (30%)
C2H2 Zn finger 346..366 CDD:275368 7/19 (37%)
zf-H2C2_2 358..383 CDD:290200 8/28 (29%)
C2H2 Zn finger 374..394 CDD:275368 6/24 (25%)
C2H2 Zn finger 401..422 CDD:275368 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X96
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.