DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and sfc2

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_594670.1 Gene:sfc2 / 2542887 PomBaseID:SPAC144.09c Length:374 Species:Schizosaccharomyces pombe


Alignment Length:229 Identity:64/229 - (27%)
Similarity:95/229 - (41%) Gaps:24/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 CNWAMCHKHMGNKYRLIEHISTHSNKKQVACFH--CGELFRTKTTLFDHLRRQPENNTNSFQCAQ 239
            |.:..|.|.......|.:|:.||||::...|.:  |.:.|..|:.|..|  ::...|...|.|..
pombe    25 CPYEECGKKYSRPSLLEQHLRTHSNERPFVCDYTGCSKAFYRKSHLKIH--KRCHTNVKPFSCHY 87

  Fly   240 --CFKFFATKKLLKSHVVRH--VNCYKCTM--CDMTCSSASSLTTHIR--YRHLKDKPLKCSECD 296
              |...|.|::.|:.|:..|  ...|.||.  ||...|....|.:||.  :.||...|....:|:
pombe    88 DGCDAQFYTQQHLERHIEVHRKPKPYACTWEGCDECFSKHQQLRSHISACHTHLLPYPCTYQDCE 152

  Fly   297 TRCVRESDLAKHVQIVHSKTV-HQCEHPDC--HYSVRTYTQMRRHFLEVHGNNPILYACHCCERF 358
            .|...:..|..||...|.|.: :.|.|..|  |.....::|::.|..|.|     :.:|..|.|.
pombe   153 LRFATKQKLQNHVNRAHEKIISYSCPHESCVGHEGFEKWSQLQNHIREAH-----VPSCSICGRQ 212

  Fly   359 FKSGKSLSAHLMKKHGFRLPSGHKRFTYRVDENG 392
            ||:...|..|:: .|...|   .:|.||.....|
pombe   213 FKTAAHLRHHVV-LHQTTL---EERKTYHCPMEG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 4/16 (25%)
C2H2 Zn finger 207..225 CDD:275368 6/19 (32%)
C2H2 Zn finger 237..257 CDD:275368 6/21 (29%)
C2H2 Zn finger 263..284 CDD:275368 8/24 (33%)
C2H2 Zn finger 292..311 CDD:275368 5/18 (28%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
sfc2NP_594670.1 COG5048 1..374 CDD:227381 64/229 (28%)
C2H2 Zn finger 28..47 CDD:275368 4/18 (22%)
C2H2 Zn finger 55..77 CDD:275368 6/23 (26%)
C2H2 Zn finger 85..107 CDD:275368 6/21 (29%)
C2H2 Zn finger 115..138 CDD:275368 8/22 (36%)
C2H2 Zn finger 146..165 CDD:275368 3/18 (17%)
C2H2 Zn finger 206..226 CDD:275368 7/20 (35%)
C2H2 Zn finger 238..261 CDD:275368 1/5 (20%)
C2H2 Zn finger 269..286 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.