DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and Zfp523

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001344924.1 Gene:Zfp523 / 224656 MGIID:2687278 Length:568 Species:Mus musculus


Alignment Length:444 Identity:104/444 - (23%)
Similarity:160/444 - (36%) Gaps:110/444 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LEHYAKAQDDRGAHAEHTEHQCTWNSCDFRTENQVEFERHSYYHGYYLNLLLQGKLECDLHPEIP 114
            ||..| |:|:.|                |.|:..|..|:::            .|:   ||    
Mouse   119 LEDLA-AEDEEG----------------FGTDTVVALEQYA------------SKV---LH---- 147

  Fly   115 ACTAPARLMEKLPALGQN-FRCGWTDCEREFVSIVEFQDHIVKHALFEYDIQKTPEDERPKTMCN 178
              .:||....|...:|.. ||||:..|.|.:.:    ..|:..|       ::....:|| ..|:
Mouse   148 --DSPASHNGKGQQVGDRAFRCGYKGCGRLYTT----AHHLKVH-------ERAHTGDRP-YRCD 198

  Fly   179 WAMCHKHMGNKYRLIEHISTHSNKKQVACFH--CGELFRTKTTLFDHLRRQPENNTNSFQC--AQ 239
            :..|.|.....|.|..|:.||:.:|...|..  |.:.|:|...|..|:|  .......|:|  ..
Mouse   199 FPSCGKAFATGYGLKSHVRTHTGEKPYKCPEELCSKAFKTSGDLQKHVR--THTGERPFRCPFEG 261

  Fly   240 CFKFFATKKLLKSHVVRHV--NCYKC--TMCDMTCSSASSLTTHIRYRHLKDKPLKCS--ECDTR 298
            |.:.|.|..:.|.||..|.  ..|.|  ..|....:||::...|:|. |..:||..|:  .|..|
Mouse   262 CGRSFTTSNIRKVHVRTHTGERPYTCPEPHCGRGFTSATNYKNHVRI-HTGEKPYVCTVPGCGKR 325

  Fly   299 CVRESDLAKHVQIVHSKTVHQCEHPDCHYSVRTYTQ---MRRHFLEVHGNNPILYACHCCERFFK 360
            ....|.|.|| .:||:    .|:...|....:||.|   :..|....||.   |.|....|:...
Mouse   326 FTEYSSLYKH-HVVHT----HCKPYTCSSCGKTYRQTSTLAMHKRSAHGE---LEATEESEQALY 382

  Fly   361 SGKSLSAHLMKKHGFRLPSGHKRFTYRVDENGFYRLETTRL--ESLEVTQQILSPQVNDSLAKPG 423
            ..:.|.|....:........|..:...|.|      |::.:  :...||::...||| ..:.:.|
Mouse   383 EQQQLEAASAAEESPPPKPTHIAYLSEVKE------ESSAIPTQVAMVTEEDGPPQV-ALITQDG 440

  Fly   424 TGSCYEIVDPTNTEFERIIVSNDPNEAQLMGEVV----------ISLPSLAEEL 467
            |..                ||..|.:.|.:|..:          :::|...|||
Mouse   441 TQQ----------------VSLSPEDLQALGSAISVVTQHGSTTLTIPGHHEEL 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 5/16 (31%)
C2H2 Zn finger 207..225 CDD:275368 6/19 (32%)
C2H2 Zn finger 237..257 CDD:275368 7/21 (33%)
C2H2 Zn finger 263..284 CDD:275368 6/22 (27%)
C2H2 Zn finger 292..311 CDD:275368 7/20 (35%)
C2H2 Zn finger 352..373 CDD:275368 3/20 (15%)
Zfp523NP_001344924.1 3 X 12 AA approximate repeats 34..99
C2H2 Zn finger 167..189 CDD:275368 6/32 (19%)
COG5048 <179..366 CDD:227381 54/202 (27%)
C2H2 Zn finger 197..219 CDD:275368 6/21 (29%)
C2H2 Zn finger 227..249 CDD:275368 7/23 (30%)
C2H2 Zn finger 257..279 CDD:275368 7/21 (33%)
C2H2 Zn finger 287..309 CDD:275368 6/22 (27%)
C2H2 Zn finger 317..339 CDD:275368 7/22 (32%)
C2H2 Zn finger 347..365 CDD:275368 5/17 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..402 7/39 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.