DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and ztf-2

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001379129.1 Gene:ztf-2 / 184429 WormBaseID:WBGene00008762 Length:360 Species:Caenorhabditis elegans


Alignment Length:344 Identity:72/344 - (20%)
Similarity:118/344 - (34%) Gaps:102/344 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KHALFEYDIQKTPEDERPKTMCNWAMCHKHMGNKYRLIEHISTHSNKKQVACFHCG-------EL 213
            |..|.|.:..:.|:||...             .|..|...:||.:      |..||       |:
 Worm    57 KRYLSEQEAIEGPDDEIEM-------------KKMELDPDVSTRT------CSTCGYQGKWVSEM 102

  Fly   214 FRTKTTLFDHLRRQPENNTNSFQCAQC-----FKFFATKKLLKSHVVRHVNCY-KCTMCDMTCSS 272
            .|.|..   |...:|      |:|..|     :|....:.:.|:|.:|.|:.| :..:.|.|.||
 Worm   103 IRHKRV---HTSERP------FKCRYCSRTSKWKADLIRHVAKTHGIRVVSKYSRSKVFDATNSS 158

  Fly   273 ASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTV-HQCEHPDCHYSVRTYTQMR 336
            ..|               .||....||:          |...:|| ::|:.  |.:.....:.:.
 Worm   159 MDS---------------SCSSDSDRCI----------ISEKRTVFYRCQL--CSFEDERVSVLN 196

  Fly   337 RHFLEVHGNNPILYACHCCERFFKSGKSLSAHLMKKHGFRLPSGHKRFTYRVDENGFYR----LE 397
            .|...:|..:|.:  |.|..:|    :.:...|...:|   |..|....|.|...  |.    |.
 Worm   197 SHVSHLHNTSPCV--CRCGAKF----EDVQGALAHSNG---PCSHVDMIYNVMPT--YEKASPLS 250

  Fly   398 TTRLESLEVTQQILSPQ-----VNDSLAKPGTGSCYEIVDPT-------NTEFERIIVSNDPNE- 449
            ..|.||...:.....|:     :..||..|..||...::.||       ..:.:..::|..||. 
 Worm   251 PCRSESSSDSGIQTDPEEEASIITSSLPTPQLGSSPLLLSPTLPVTPSFLPDIQSALLSLQPNPL 315

  Fly   450 -----AQLMGEVVISLPSL 463
                 |.|:...:::.|::
 Worm   316 MSLYLASLLQSSLLNSPTI 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 3/16 (19%)
C2H2 Zn finger 207..225 CDD:275368 7/24 (29%)
C2H2 Zn finger 237..257 CDD:275368 5/24 (21%)
C2H2 Zn finger 263..284 CDD:275368 5/20 (25%)
C2H2 Zn finger 292..311 CDD:275368 4/18 (22%)
C2H2 Zn finger 352..373 CDD:275368 4/20 (20%)
ztf-2NP_001379129.1 C2H2 Zn finger 89..109 CDD:275370 6/22 (27%)
zf-H2C2_5 115..139 CDD:404746 5/23 (22%)
C2H2 Zn finger 117..138 CDD:275370 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X96
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.