DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and Y111B2A.10

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_499640.1 Gene:Y111B2A.10 / 176678 WormBaseID:WBGene00013734 Length:430 Species:Caenorhabditis elegans


Alignment Length:285 Identity:57/285 - (20%)
Similarity:102/285 - (35%) Gaps:89/285 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 GQNFRCGWTDCEREFVSIVEFQDHIVK-HALFEYDIQKTPEDERPKTMCNWAMCHKHMGNKYRLI 193
            |..|.|  ..|.:.|.:....|.|..: |.|           .|.|..|.  :|.|....|..|.
 Worm   143 GSIFTC--VMCSKAFPNAEALQIHTDQVHDL-----------SRLKHRCK--LCGKAYKRKKNLD 192

  Fly   194 EHISTHSNKKQVACFHCGELFRTKTTLFDHLRRQPENNTNSFQ-----CAQCFKFFAT------- 246
            .|::.|  .|::.|.:|..:|:::.:|..|:.|..:.:.:..:     |:.|.:.|.:       
 Worm   193 AHMALH--LKEIQCDNCSLVFQSEKSLQSHIIRHHQEDADELEVWKAPCSICKELFPSTSVKTHE 255

  Fly   247 ------KKLLKSHVVRHV---------------------NC----------YK---CTMCDMTCS 271
                  :|:::...|..:                     :|          |:   |.:|..:.:
 Worm   256 WYCKNREKIIEKQRVSKILKVQSLPSSPALSTVSYASFSSCQPGPITSPVSYRDKSCQVCGESFA 320

  Fly   272 SASSLTTHIRYRHLKDK------------------PLKCSECDTRCVRESDLAKHVQIVHSKTVH 318
            |..|:..|:..:|...|                  |..|.||..|....:.|:.|...|||:: :
 Worm   321 SRQSMLRHVGRKHPDAKNDPNVTAVRYISAESPKHPYACIECGKRFTTVTALSTHKARVHSQS-N 384

  Fly   319 QCEHPDCHYSVRTYTQMRRHFLEVH 343
            :.|...||.|....:::|:|...||
 Worm   385 RFECTICHKSYPVPSELRKHIKRVH 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 5/16 (31%)
C2H2 Zn finger 207..225 CDD:275368 5/17 (29%)
C2H2 Zn finger 237..257 CDD:275368 5/32 (16%)
C2H2 Zn finger 263..284 CDD:275368 5/20 (25%)
C2H2 Zn finger 292..311 CDD:275368 6/18 (33%)
C2H2 Zn finger 352..373 CDD:275368
Y111B2A.10NP_499640.1 C2H2 Zn finger 148..169 CDD:275368 5/22 (23%)
zf-C2H2_8 151..221 CDD:292531 20/84 (24%)
C2H2 Zn finger 178..198 CDD:275368 6/21 (29%)
C2H2 Zn finger 204..224 CDD:275368 5/19 (26%)
C2H2 Zn finger 312..333 CDD:275368 5/20 (25%)
C2H2 Zn finger 359..380 CDD:275368 6/20 (30%)
C2H2 Zn finger 388..409 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X96
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.